PCID2_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PCID2_DROME
• UniProt AC: Q9VTL1
• Protein Name: PCI domain-containing protein 2 homolog
• Gene Name: PCID2
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 395
• Subcellular Localization: Nucleus . Cytoplasm . Shuttles in and out of the nucleus by a emb/Crm1-dependent mechanism.
• Protein Description: Required for mRNA export together with Moe. [PubMed: 18086857]
• Protein Sequence: MFGTVNNYLSGVLHAAQDLDGESLATYLSLRDVHVQNHNLYIAQPEKLVDRFLKPPLDEVVSAHLKVLYHLAQEPPGYMEAYTQQSAACGAVVRLLQQLKDENWCLPLMYRVCLDLRYLAQACEKHCQGFTPGHVLEKAADCIMACFRVCAADGRASEEDTKRLGMMNLVNQLFKIYFRINKLHLCKPLIRAIDNCIFKDSFPLPEQITYKYFVGRRAMFDSNYQAAVQYLSYAFSNCPDRFASNKRLILIYLVPVKMLLGYLPSKSLLQRYDLLLFLDLAMAMKAGNVNRFDEIVRDQELVLIRSGIYLLVEKLKFLVYRNLFKKVFVIRKSHQLDMGDFLSALHFVGLTDVSLDETHCIVANLIYDGKIKGYISHAHNKLVVSKQNPFPSVSL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
131	Phosphorylation	EKHCQGFTPGHVLEK HHHCCCCCCHHHHHH	34.87	21082442

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PCID2_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PCID2_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PCID2_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NXF1_DROME	sbr	physical	18086857

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.