UniProt ID | THOC7_DROME | |
---|---|---|
UniProt AC | Q8IRJ8 | |
Protein Name | THO complex protein 7 | |
Gene Name | thoc7 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 288 | |
Subcellular Localization | Cytoplasm . Nucleus . Nucleus speckle . | |
Protein Description | The THO complex is required for cell proliferation and for proper export of heat-shock mRNAs under heat stress.. | |
Protein Sequence | MSEQCQLRPHSDTLVRKLVEMNDEEIIKQRLLIDGDGTGEDRRIVVLLKQFLKWASDSLDSNPIMYDRLMAQFAQCKLTALKNVQTLQMIAGERDNYTQLVEHHEESIVLAKAEIESSKKELITAKQIRKNKMEYDLLASLIQDQPDRSETQRHIETIRREIDDLVQKKLKMERKFQKRRNDFTLLMYTIHELEQQLDQDSSSSASSSSSDCDARSEPDLDDNGIMEVSDEDDDLNNSTPTKFDGARGEPKYHSVSTEDSKAMSVEEDTVLELSIDKDEHDVDVAVAN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
216 | Phosphorylation | SSDCDARSEPDLDDN CCCCCCCCCCCCCCC | 56.02 | 19429919 | |
229 | Phosphorylation | DNGIMEVSDEDDDLN CCCEEECCCCCCCCC | 23.21 | 19429919 | |
254 | Phosphorylation | RGEPKYHSVSTEDSK CCCCCCCCCCCCCCC | 18.05 | 19429919 | |
256 | Phosphorylation | EPKYHSVSTEDSKAM CCCCCCCCCCCCCCC | 29.15 | 18327897 | |
260 | Phosphorylation | HSVSTEDSKAMSVEE CCCCCCCCCCCCCCC | 18.97 | 15133499 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of THOC7_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of THOC7_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of THOC7_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CCDCX_DROME | CG32809 | physical | 14605208 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-216; SER-229; SER-256AND SER-260, AND MASS SPECTROMETRY. |