dbPTM

OB56H_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	OB56H_DROME
UniProt AC	Q9V8Y9
Protein Name	General odorant-binding protein 56h
Gene Name	Obp56h
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	134
Subcellular Localization	Secreted.
Protein Description	Present in the aqueous fluid surrounding olfactory sensory dendrites and are thought to aid in the capture and transport of hydrophobic odorants into and through this fluid (By similarity). May function in both olfactory and gustatory systems..
Protein Sequence	MKFTLFCIALAAFLSMGQCNPDFRQIMQQCMETNQVTEADLKEFMASGMQSSAKENLKCYTKCLMEKQGHLTNGQFNAQAMLDTLKNVPQIKDKMDEISSGVNACKDIKGTNDCDTAFKVTMCLKEHKAIPGHH

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of OB56H_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of OB56H_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of OB56H_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of OB56H_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of OB56H_DROME !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of OB56H_DROME

Related Literatures of Post-Translational Modification