UniProt ID | BTHD_DROME | |
---|---|---|
UniProt AC | Q9VYB0 | |
Protein Name | Selenoprotein BthD | |
Gene Name | BthD | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 249 | |
Subcellular Localization | Cytoplasm . Secreted . Secreted into the salivary gland lumen. | |
Protein Description | May be involved in a redox-related process. Required for survival and specifically for salivary gland morphogenesis.. | |
Protein Sequence | MPPKRNKKAEAPIAERDAGEELDPNAPVLYVEHCRSURVFRRRAEELHSALRERGLQQLQLQLNALGAPRRGAFELSLSAGGMGKQEQVALWSGLKRGPPRARKFPTVEEVYDQIVGILGDQQESKEQTNTQKSSKIDLPGSEAIASPKKSESTEEAQENKAPTSTSTSRKSKKEQKSEEEPTQVDSKEAKQSKELVKTKRQPKAQKKQAKASESQEEVAEDKPPSSQKRKRTTRSSTDEATAGAKRRR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
147 | Phosphorylation | PGSEAIASPKKSEST CCCHHCCCCCCCCCH | 31.01 | 28490779 | |
178 | Phosphorylation | KSKKEQKSEEEPTQV HHHHHHCCCCCCCCC | 50.35 | 25749252 | |
236 | Phosphorylation | KRKRTTRSSTDEATA HCCCCCCCCHHHHHH | 35.18 | 21082442 | |
237 | Phosphorylation | RKRTTRSSTDEATAG CCCCCCCCHHHHHHH | 36.27 | 25749252 | |
238 | Phosphorylation | KRTTRSSTDEATAGA CCCCCCCHHHHHHHH | 38.82 | 29892262 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BTHD_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BTHD_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BTHD_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
WDR82_DROME | Wdr82 | physical | 22036573 | |
HPF1_DROME | CG1218 | physical | 22036573 | |
GMPPB_DROME | CG1129 | physical | 22036573 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"An integrated chemical, mass spectrometric and computational strategyfor (quantitative) phosphoproteomics: application to Drosophilamelanogaster Kc167 cells."; Bodenmiller B., Mueller L.N., Pedrioli P.G.A., Pflieger D.,Juenger M.A., Eng J.K., Aebersold R., Tao W.A.; Mol. Biosyst. 3:275-286(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-147, AND MASSSPECTROMETRY. |