UniProt ID | SSBP_DROME | |
---|---|---|
UniProt AC | P54622 | |
Protein Name | Single-stranded DNA-binding protein, mitochondrial | |
Gene Name | mtSSB | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 146 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | This protein binds preferentially and cooperatively to pyrimidine rich ss-DNA. Required for mitochondrial DNA replication.. | |
Protein Sequence | MQHTRRMLNPLLTGLRNLPARGATTTTAAAPAKVEKTVNTVTILGRVGADPQLRGSQEHPVVTFSVATHTNYKYENGDWAQRTDWHRVVVFKPNLRDTVLEYLKKGQRTMVQGKITYGEITDQQGNQKTSTSIIADDVLFFRDANN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
36 | Acetylation | AAPAKVEKTVNTVTI CCCCEEECEECEEEE | 61.84 | 21791702 | |
92 | Acetylation | WHRVVVFKPNLRDTV CEEEEEECCCHHHHH | 22.76 | 21791702 | |
104 | Acetylation | DTVLEYLKKGQRTMV HHHHHHHHHCCCEEE | 54.69 | 21791702 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SSBP_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SSBP_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SSBP_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TNG2_DROME | Tango2 | physical | 22036573 | |
ORN_DROME | CG10214 | physical | 22036573 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...