| UniProt ID | CALR_DROME | |
|---|---|---|
| UniProt AC | P29413 | |
| Protein Name | Calreticulin {ECO:0000303|PubMed:1296819} | |
| Gene Name | Calr {ECO:0000312|FlyBase:FBgn0005585} | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 406 | |
| Subcellular Localization | Endoplasmic reticulum lumen. | |
| Protein Description | Molecular calcium-binding chaperone promoting folding, oligomeric assembly and quality control in the ER via the calreticulin/calnexin cycle. This lectin may interact transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER (By similarity).. | |
| Protein Sequence | MMWCKTVIVLLATVGFISAEVYLKENFDNENWEDTWIYSKHPGKEFGKFVLTPGTFYNDAEADKGIQTSQDARFYAASRKFDGFSNEDKPLVVQFSVKHEQNIDCGGGYVKLFDCSLDQTDMHGESPYEIMFGPDICGPGTKKVHVIFSYKGKNHLISKDIRCKDDVYTHFYTLIVRPDNTYEVLIDNEKVESGNLEDDWDFLAPKKIKDPTATKPEDWDDRATIPDPDDKKPEDWDKPEHIPDPDATKPEDWDDEMDGEWEPPMIDNPEFKGEWQPKQLDNPNYKGAWEHPEIANPEYVPDDKLYLRKEICTLGFDLWQVKSGTIFDNVLITDDVELAAKAAAEVKNTQAGEKKMKEAQDEVQRKKDEEEAKKASDKDDEDEDDDDEEKDDESKQDKDQSEHDEL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 159 | Acetylation | GKNHLISKDIRCKDD CCCEEECCCEECCCC | 50.62 | 21791702 | |
| 376 | Phosphorylation | EEEAKKASDKDDEDE HHHHHHHCCCCCCCC | 54.82 | 19429919 | |
| 394 | Phosphorylation | DEEKDDESKQDKDQS CCCCCHHHHHHHHHH | 42.48 | 29892262 | |
| 401 | Phosphorylation | SKQDKDQSEHDEL-- HHHHHHHHHCCCC-- | 47.21 | 19429919 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CALR_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CALR_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CALR_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| NLP_DROME | Nlp | physical | 22036573 | |
| PDI_DROME | Pdi | physical | 22036573 | |
| SH3BG_DROME | Sh3beta | physical | 22036573 | |
| FKB12_DROME | FK506-bp2 | physical | 22036573 | |
| NACA_DROME | Nacalpha | physical | 22036573 | |
| MOEH_DROME | Moe | physical | 22036573 | |
| INO1_DROME | Inos | physical | 22036573 | |
| TRXR1_DROME | Trxr-1 | physical | 22036573 | |
| THIO2_DROME | Trx-2 | physical | 22036573 | |
| PCNA_DROME | PCNA | physical | 22036573 | |
| HCD2_DROME | scu | physical | 22036573 | |
| YC17_DROME | CG16817 | physical | 22036573 | |
| TCTP_DROME | Tctp | physical | 22036573 | |
| UCHL_DROME | Uch | physical | 22036573 | |
| ATPB_DROME | ATPsyn-beta | physical | 22036573 | |
| EF1D_DROME | eEF1delta | physical | 22036573 | |
| TERA_DROME | TER94 | physical | 22036573 | |
| 1433E_DROME | 14-3-3epsilon | physical | 22036573 | |
| IF5A_DROME | eIF-5A | physical | 22036573 | |
| PSA6_DROME | Prosalpha1 | physical | 22036573 | |
| DOD_DROME | dod | physical | 22036573 | |
| FAXC_DROME | fax | physical | 22036573 | |
| WDR1_DROME | flr | physical | 22036573 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
