UniProt ID | CALR_DROME | |
---|---|---|
UniProt AC | P29413 | |
Protein Name | Calreticulin {ECO:0000303|PubMed:1296819} | |
Gene Name | Calr {ECO:0000312|FlyBase:FBgn0005585} | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 406 | |
Subcellular Localization | Endoplasmic reticulum lumen. | |
Protein Description | Molecular calcium-binding chaperone promoting folding, oligomeric assembly and quality control in the ER via the calreticulin/calnexin cycle. This lectin may interact transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER (By similarity).. | |
Protein Sequence | MMWCKTVIVLLATVGFISAEVYLKENFDNENWEDTWIYSKHPGKEFGKFVLTPGTFYNDAEADKGIQTSQDARFYAASRKFDGFSNEDKPLVVQFSVKHEQNIDCGGGYVKLFDCSLDQTDMHGESPYEIMFGPDICGPGTKKVHVIFSYKGKNHLISKDIRCKDDVYTHFYTLIVRPDNTYEVLIDNEKVESGNLEDDWDFLAPKKIKDPTATKPEDWDDRATIPDPDDKKPEDWDKPEHIPDPDATKPEDWDDEMDGEWEPPMIDNPEFKGEWQPKQLDNPNYKGAWEHPEIANPEYVPDDKLYLRKEICTLGFDLWQVKSGTIFDNVLITDDVELAAKAAAEVKNTQAGEKKMKEAQDEVQRKKDEEEAKKASDKDDEDEDDDDEEKDDESKQDKDQSEHDEL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
159 | Acetylation | GKNHLISKDIRCKDD CCCEEECCCEECCCC | 50.62 | 21791702 | |
376 | Phosphorylation | EEEAKKASDKDDEDE HHHHHHHCCCCCCCC | 54.82 | 19429919 | |
394 | Phosphorylation | DEEKDDESKQDKDQS CCCCCHHHHHHHHHH | 42.48 | 29892262 | |
401 | Phosphorylation | SKQDKDQSEHDEL-- HHHHHHHHHCCCC-- | 47.21 | 19429919 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CALR_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CALR_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CALR_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NLP_DROME | Nlp | physical | 22036573 | |
PDI_DROME | Pdi | physical | 22036573 | |
SH3BG_DROME | Sh3beta | physical | 22036573 | |
FKB12_DROME | FK506-bp2 | physical | 22036573 | |
NACA_DROME | Nacalpha | physical | 22036573 | |
MOEH_DROME | Moe | physical | 22036573 | |
INO1_DROME | Inos | physical | 22036573 | |
TRXR1_DROME | Trxr-1 | physical | 22036573 | |
THIO2_DROME | Trx-2 | physical | 22036573 | |
PCNA_DROME | PCNA | physical | 22036573 | |
HCD2_DROME | scu | physical | 22036573 | |
YC17_DROME | CG16817 | physical | 22036573 | |
TCTP_DROME | Tctp | physical | 22036573 | |
UCHL_DROME | Uch | physical | 22036573 | |
ATPB_DROME | ATPsyn-beta | physical | 22036573 | |
EF1D_DROME | eEF1delta | physical | 22036573 | |
TERA_DROME | TER94 | physical | 22036573 | |
1433E_DROME | 14-3-3epsilon | physical | 22036573 | |
IF5A_DROME | eIF-5A | physical | 22036573 | |
PSA6_DROME | Prosalpha1 | physical | 22036573 | |
DOD_DROME | dod | physical | 22036573 | |
FAXC_DROME | fax | physical | 22036573 | |
WDR1_DROME | flr | physical | 22036573 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...