UniProt ID | MIP_DROME | |
---|---|---|
UniProt AC | Q9VVF7 | |
Protein Name | Allatostatins MIP | |
Gene Name | Mip | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 211 | |
Subcellular Localization | Secreted. | |
Protein Description | Ligand for the sex peptide receptor (SPR). [PubMed: 20308537] | |
Protein Sequence | MAHTKTRRTYGFLMVLLILGSACGNLVASGSAGSPPSNEPGGGGLSEQVVLDQLSESDLYGNNKRAWQSLQSSWGKRSSSGDVSDPDIYMTGHFVPLVITDGTNTIDWDTFERLASGQSAQQQQQQPLQQQSQSGEDFDDLAGEPDVEKRAWKSMNVAWGKRRQAQGWNKFRGAWGKREPTWNNLKGMWGKRDQWQKLHGGWGKRSQLPSN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
74 | Tryptophan amide | WQSLQSSWGKRSSSG HHHHHHHCCCCCCCC | 22.90 | - | |
74 | Amidation | WQSLQSSWGKRSSSG HHHHHHHCCCCCCCC | 22.90 | - | |
159 | Tryptophan amide | WKSMNVAWGKRRQAQ HHHCCHHHHHHHHHH | 14.46 | - | |
159 | Amidation | WKSMNVAWGKRRQAQ HHHCCHHHHHHHHHH | 14.46 | 12171930 | |
175 | Tryptophan amide | WNKFRGAWGKREPTW HHHCCCCCCCCCCCH | 18.70 | - | |
175 | Amidation | WNKFRGAWGKREPTW HHHCCCCCCCCCCCH | 18.70 | 21214272 | |
189 | Tryptophan amide | WNNLKGMWGKRDQWQ HHHCCCCCCCHHHHH | 20.16 | - | |
189 | Amidation | WNNLKGMWGKRDQWQ HHHCCCCCCCHHHHH | 20.16 | 21214272 | |
202 | Tryptophan amide | WQKLHGGWGKRSQLP HHHHCCCCCCCCCCC | 17.46 | - | |
202 | Amidation | WQKLHGGWGKRSQLP HHHHCCCCCCCCCCC | 17.46 | 12171930 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MIP_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MIP_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MIP_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of MIP_DROME !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...