dbPTM

HMGD_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	HMGD_DROME
UniProt AC	Q05783
Protein Name	High mobility group protein D
Gene Name	HmgD
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	112
Subcellular Localization	Nucleus. Chromosome.
Protein Description	Binds preferentially single-stranded DNA and unwinds double-stranded DNA. Prefers sites containing the sequence 5'-ttg-3'. Facilitates DNA bending. Associated with early embryonic chromatin in the absence of histone H1..
Protein Sequence	MSDKPKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAMKDKSEWEAKAAKAKDDYDRAVKEFEANGGSSAANGGGAKKRAKPAKKVAKKSKKEESDEDDDDESE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
10	Phosphorylation	DKPKRPLSAYMLWLN CCCCCCHHHHHHHHH	21.75	19429919
12	Phosphorylation	PKRPLSAYMLWLNSA CCCCHHHHHHHHHHH	6.86	19429919
13	Sulfoxidation	KRPLSAYMLWLNSAR CCCHHHHHHHHHHHH	1.85	9323026
76	Phosphorylation	EFEANGGSSAANGGG HHHHCCCCCCCCCCC	20.43	30478224
77	Phosphorylation	FEANGGSSAANGGGA HHHCCCCCCCCCCCH	34.37	27794539
103	Phosphorylation	KKSKKEESDEDDDDE HHHHHHCCCCCCCCC	47.60	21082442
111	Phosphorylation	DEDDDDESE------ CCCCCCCCC------	56.45	19429919

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of HMGD_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of HMGD_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of HMGD_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
YC17_DROME	CG16817	physical	22036573
NACA_DROME	Nacalpha	physical	22036573
NLP_DROME	Nlp	physical	22036573
CALR_DROME	Crc	physical	22036573
PDI_DROME	Pdi	physical	22036573

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of HMGD_DROME

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-10; TYR-12; SER-103 ANDSER-111, AND MASS SPECTROMETRY.	18327897 [Abstract]
"An integrated chemical, mass spectrometric and computational strategyfor (quantitative) phosphoproteomics: application to Drosophilamelanogaster Kc167 cells."; Bodenmiller B., Mueller L.N., Pedrioli P.G.A., Pflieger D.,Juenger M.A., Eng J.K., Aebersold R., Tao W.A.; Mol. Biosyst. 3:275-286(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-103 AND SER-111, ANDMASS SPECTROMETRY.	17372656 [Abstract]