| UniProt ID | FADD_DROME | |
|---|---|---|
| UniProt AC | Q9V3B4 | |
| Protein Name | Fas-associated death domain protein | |
| Gene Name | Fadd | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 239 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | Component of the IMD signaling pathway and is required for the host defense against Gram-negative bacteria. Interacts with Dredd, promotes cleavage of Dredd and is necessary and sufficient for enhancing Dredd-induced apoptosis.. | |
| Protein Sequence | MTAGRHWSYDSLKQIAIDGCTENVEQLKLIFVEEIGSRRRSDCIRTIEDLIDCLERADELSEYNVEPLRRISGNMPQLIEALSAYTKPENILGHPVNLYQELRLAEELRQQLRIAPASQNAQPSVSELAAAVPPTAIQNYATPAAFTDHKRTMVFKKISEELGRYWRRLGRSAGIGEGQMDTIEERYPHDLKSQILRLLQLIEEDDCHDPKHFLLRLCRALGDCGRNDLRKRVEQIMSH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of FADD_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FADD_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FADD_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FADD_DROME !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
