NH2L1_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NH2L1_DROME
• UniProt AC: Q9U3Z7
• Protein Name: NHP2-like protein 1 homolog
• Gene Name: hoip
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 127
• Subcellular Localization: Nucleus, nucleolus.
• Protein Description: Binds to the 5'-stem-loop of U4 snRNA and may play a role in the late stage of spliceosome assembly. The protein undergoes a conformational change upon RNA-binding (By similarity)..
• Protein Sequence: MTEEVNPKAFPLADAQLTAKIMNLLQQALNYNQLRKGANEATKTLNRGLADIVVLAGDAEPIEILLHLPLLCEDKNVPYVFVRSKQALGRACGVSRPIVACSVTTNEGSQLKSQITSIQQEIERLLV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of NH2L1_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NH2L1_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NH2L1_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NH2L1_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CNN_DROME	cnn	physical	14605208
EIF3B_DROME	eIF3-S9	physical	14605208
TPM2_DROME	Tm2	genetic	26293307

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.