UniProt ID | RL7A_DROME | |
---|---|---|
UniProt AC | P46223 | |
Protein Name | 60S ribosomal protein L7a | |
Gene Name | RpL7A | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 271 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MVVKKPRPKKKPVTKKVAPAPLAVKKPVVKKVVNQLFEKRPKNFGIGQNVQPKRDLSRFVRWPKYIRVQRQKAVLQKRLKVPPPIHQFSQTLDKTTAVKLFKLLEKYRPESPLAKKLRLKKIAEAKAKGKDVEPKKKPSYVSAGTNTVTKLIEQKKAQLVVIAHDVDPLELVLFLPALCRKMGVPYCIVKGKARLGRLVRRKTCTTLALTTVDNNDKANFGKVLEAVKTNFNERHEEIRRHWGGGILGSKSLARISKLERAKARELAQKQG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
31 | Acetylation | VKKPVVKKVVNQLFE CCHHHHHHHHHHHHH | 39.54 | 21791702 | |
39 | Acetylation | VVNQLFEKRPKNFGI HHHHHHHHCCCCCCC | 67.67 | 21791702 | |
102 | Acetylation | TTAVKLFKLLEKYRP HHHHHHHHHHHHHCC | 63.70 | 21791702 | |
106 | Acetylation | KLFKLLEKYRPESPL HHHHHHHHHCCCCHH | 46.67 | 21791702 | |
107 | Phosphorylation | LFKLLEKYRPESPLA HHHHHHHHCCCCHHH | 23.25 | 25749252 | |
111 | Phosphorylation | LEKYRPESPLAKKLR HHHHCCCCHHHHHHH | 28.09 | 19429919 | |
222 | Acetylation | NDKANFGKVLEAVKT CCCCCHHHHHHHHHH | 39.24 | 21791702 | |
250 | Acetylation | GGGILGSKSLARISK CCCCCCCHHHHHHHH | 47.92 | 21791702 | |
257 | Acetylation | KSLARISKLERAKAR HHHHHHHHHHHHHHH | 52.58 | 21791702 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL7A_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL7A_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL7A_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GCM2_DROME | gcm2 | physical | 14605208 | |
HSP6A_DROME | Hsp67Ba | physical | 14605208 | |
POXM_DROME | Poxm | physical | 14605208 | |
CLU_DROME | clu | physical | 26834020 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...