UniProt ID | PRDX1_DROME | |
---|---|---|
UniProt AC | Q9V3P0 | |
Protein Name | Peroxiredoxin 1 | |
Gene Name | Jafrac1 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 194 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2) (By similarity). Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation (By similarity).. | |
Protein Sequence | MPQLQKPAPAFAGTAVVNGVFKDIKLSDYKGKYLVLFFYPLDFTFVCPTEIIAFSESAAEFRKINCEVIGCSTDSQFTHLAWINTPRKQGGLGSMDIPLLADKSMKVARDYGVLDEETGIPFRGLFIIDDKQNLRQITVNDLPVGRSVEETLRLVQAFQYTDKYGEVCPANWKPGQKTMVADPTKSKEYFETTS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
27 | Phosphorylation | VFKDIKLSDYKGKYL EEECEECHHCCCCEE | 33.61 | 19429919 | |
94 | Phosphorylation | RKQGGLGSMDIPLLA CHHCCCCCCCHHHHC | 20.51 | 19429919 | |
193 | Phosphorylation | SKEYFETTS------ CHHHHCCCC------ | 25.82 | 18327897 | |
194 | Phosphorylation | KEYFETTS------- HHHHCCCC------- | 45.72 | 18327897 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PRDX1_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PRDX1_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PRDX1_DROME !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-193 AND SER-194, ANDMASS SPECTROMETRY. |