UniProt ID | RL24_DROME | |
---|---|---|
UniProt AC | Q9VJY6 | |
Protein Name | 60S ribosomal protein L24 | |
Gene Name | RpL24 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 155 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MKIGLCAFSGYKIYPGHGKTMVKIDGKSFTFLDKKCERSYLMKRNPRKVTWTVLYRRKHRKGIEEEASKKRTRRTQKFQRAIVGASLAEILAKRNMKPEVRKAQRDQAIKVAKEQKRAVKAAKKAAAPAPAKKSAPKQKAAKVTQKAAPRVGGKR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
27 | Acetylation | TMVKIDGKSFTFLDK EEEEECCEEEEEECH | 38.35 | 21791702 | |
34 | Acetylation | KSFTFLDKKCERSYL EEEEEECHHHHHHHH | 62.56 | 21791702 | |
68 | Phosphorylation | KGIEEEASKKRTRRT CCCHHHHHHHHHHHH | 41.83 | 27794539 | |
86 | Phosphorylation | QRAIVGASLAEILAK HHHHHHHHHHHHHHH | 23.37 | 28490779 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL24_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL24_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL24_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...