RAC2_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RAC2_DROME
• UniProt AC: P48554
• Protein Name: Ras-related protein Rac2
• Gene Name: Rac2
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 192
• Subcellular Localization: Cell membrane ; Lipid-anchor ; Cytoplasmic side .
• Protein Description: Involved in integrin alpha-PS3/beta-nu-mediated phagocytosis of Gram-positive S.aureus by hemocytes..
• Protein Sequence: MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSVPIILVGTKLDLRDDKQTIEKLKDKKLTPITYPQGLAMAKEIAAVKYLECSALTQKGLKTVFDEAIRSVLCPVVRGPKRHKCALL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
64	Phosphorylation	DTAGQEDYDRLRPLS CCCCCCCHHHCCCCC	11.38	19429919
189	Methylation	RGPKRHKCALL---- CCCCCCCCCCC----	2.35	-
189	Geranylgeranylation	RGPKRHKCALL---- CCCCCCCCCCC----	2.35	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RAC2_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RAC2_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RAC2_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CCNE_DROME	CycE	genetic	12242236
TTKB_DROME	ttk	genetic	23545328
TTKA_DROME	ttk	genetic	23545328

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.