UniProt ID | RAC2_DROME | |
---|---|---|
UniProt AC | P48554 | |
Protein Name | Ras-related protein Rac2 | |
Gene Name | Rac2 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 192 | |
Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . |
|
Protein Description | Involved in integrin alpha-PS3/beta-nu-mediated phagocytosis of Gram-positive S.aureus by hemocytes.. | |
Protein Sequence | MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSVPIILVGTKLDLRDDKQTIEKLKDKKLTPITYPQGLAMAKEIAAVKYLECSALTQKGLKTVFDEAIRSVLCPVVRGPKRHKCALL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
64 | Phosphorylation | DTAGQEDYDRLRPLS CCCCCCCHHHCCCCC | 11.38 | 19429919 | |
189 | Methylation | RGPKRHKCALL---- CCCCCCCCCCC---- | 2.35 | - | |
189 | Geranylgeranylation | RGPKRHKCALL---- CCCCCCCCCCC---- | 2.35 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RAC2_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RAC2_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RAC2_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CCNE_DROME | CycE | genetic | 12242236 | |
TTKB_DROME | ttk | genetic | 23545328 | |
TTKA_DROME | ttk | genetic | 23545328 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...