UniProt ID | ARF6_DROME | |
---|---|---|
UniProt AC | P40946 | |
Protein Name | ADP-ribosylation factor 6 {ECO:0000305} | |
Gene Name | Arf51F {ECO:0000312|FlyBase:FBgn0013750} | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 175 | |
Subcellular Localization | Golgi apparatus. | |
Protein Description | GTP-binding protein involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus (By similarity). Promotes cell movement and remodeling of the actin cytoskeleton during compound eye morphogenesis. [PubMed: 21976699] | |
Protein Sequence | MGKLLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARTELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLSEGLIWLTSNHKL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARF6_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARF6_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARF6_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SAHH_DROME | Ahcy13 | physical | 15710747 | |
DCN1L_DROME | CG7427 | physical | 15710747 | |
PCNA_DROME | PCNA | physical | 15710747 | |
NFS1_DROME | CG12264 | physical | 15710747 | |
RNH2A_DROME | CG13690 | physical | 15710747 | |
BRUN_DROME | bru | physical | 15710747 | |
APLP_DROME | Rfabg | physical | 15710747 | |
RG190_DROME | RhoGAPp190 | physical | 15710747 | |
RLIP_DROME | Rlip | physical | 15710747 | |
AMN_DROME | amn | genetic | 23223291 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...