dbPTM

AMN_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	AMN_DROME
UniProt AC	Q24049
Protein Name	Amnesiac neuropeptides
Gene Name	amn
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	180
Subcellular Localization	Secreted .
Protein Description	Required for associative learning and memory in adults. Expression pattern suggests a modulatory role in memory formation. Controls neurotransmitter-mediated signaling pathways associated with the structure of the larval peripheral nerve..
Protein Sequence	MRSFCCCFYPAAVALHCVLLFYTFFLLFRASALRRRVVSGSKGSAALALCRQFEQLSASRRERAEECRTTQLRYHYHRNGAQSRSLCAAVLCCKRSYIPRPNFSCFSLVFPVGQRFAAARTRFGPTLVASWPLCNDSETKVLTKWPSCSLIGRRSVPRGQPKFSRENPRALSPSLLGEMR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of AMN_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of AMN_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of AMN_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of AMN_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
CYA1_DROME	rut	genetic	9635429

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of AMN_DROME

Related Literatures of Post-Translational Modification