DCN1L_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DCN1L_DROME
• UniProt AC: Q9VUQ8
• Protein Name: DCN1-like protein
• Gene Name: CG7427
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 288
• Protein Description: May contribute to neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes. Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity (By similarity)..
• Protein Sequence: MNKLKSSTHRDKVKKFISLTHTGEQTAIFCLQQNDWKFELASDNYFQNPEYYYRELDRKRIEQLFMRYRDPSDPLKIGSQGVIHFLEDLDLKPDSKLVLIIAWKFHAEVQCEFSRDEFINGMCDLGIDSIDKLKTKLPILEQELNDAGKFKDFYHFTFNYAKDPGQKGIDLEMAIAYWCIVLSGRFKFLDIWCQFLEEKHKRAISRDTWNLLLDFATNIDDRMSNYDSEGAWPVLIDDFVEWCQENDHLKEDSSPASGYQQQSSASSSSQKNISSAYQTSHSTNMNYG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
282	Phosphorylation	SAYQTSHSTNMNYG- HHCHHCCCCCCCCC-	22.65	21082442

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DCN1L_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DCN1L_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DCN1L_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.