dbPTM

RG84C_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RG84C_DROME
UniProt AC	P40809
Protein Name	GTPase-activating protein RacGAP84C
Gene Name	RacGAP84C
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	384
Subcellular Localization
Protein Description	Involved in the morphogenesis of the adult appendages. GTPase-activating protein for p21-Rac. Promotes the exchange of Rac-bound GDP by GTP..
Protein Sequence	MISGSGSRTPSNRLYLSPVRPTMQNKRRLLREYRSYDDLSEHYRMFGSQSLDSLQDRVDMNPSGCDGLSTDGLDFCSQSHSGLLREHNFKIKSYYYNVGNCVHCRKRIRFAMASLRCRACPLRCHIGCCRQLTVNCIPQPQIGTKRGCLSDYAPRVAPMVPALIVHCVTEIEARGLQQEGLYRVSSTREKCKRLRRKLLRGKSTPHLGNKDTHTLCCCVKDFLRQLVHPLIPIYHRRDFEEATRHEDRLAVEMAVYLAVLELHQAHRDTLAYLMLHWQKIAESPAVRMTVNNLAVIFAPTLFGDLDLTLENVVTWQRVLKVLLLMPAGFWSQFLEVHPLPTSLGSTYDFEDRYNHRHWDSSSNLGWSSVKTYFRSMVNLSSTHL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of RG84C_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RG84C_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RG84C_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RG84C_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
C3G_DROME	C3G	genetic	15169836
NUMB_DROME	numb	genetic	15169836
CHK1_DROME	grp	genetic	15169836
DOM_DROME	dom	genetic	15169836
CPO_DROME	cpo	genetic	15169836
POE_DROME	poe	genetic	15169836

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RG84C_DROME

Related Literatures of Post-Translational Modification