UniProt ID | DSX_DROME | |
---|---|---|
UniProt AC | P23023 | |
Protein Name | Protein doublesex | |
Gene Name | dsx | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 549 | |
Subcellular Localization | Nucleus. | |
Protein Description | Controls somatic sexual differentiation. Binds directly and specifically to the FBE (fat body enhancer) of the yolk protein 1 and 2 genes (Yp1 and Yp2). This enhancer is sufficient to direct the female-specific transcription characteristic of the Yp genes in adult fat bodies. Involved in regulation of male-specific expression of takeout in brain-associated fat body.. | |
Protein Sequence | MVSEENWNSDTMSDSDMIDSKNDVCGGASSSSGSSISPRTPPNCARCRNHGLKITLKGHKRYCKFRYCTCEKCRLTADRQRVMALQTALRRAQAQDEQRALHMHEVPPANPAATTLLSHHHHVAAPAHVHAHHVHAHHAHGGHHSHHGHVLHHQQAAAAAAAAPSAPASHLGGSSTAASSIHGHAHAHHVHMAAAAAASVAQHQHQSHPHSHHHHHQNHHQHPHQQPATQTALRSPPHSDHGGSVGPATSSSGGGAPSSSNAAAATSSNGSSGGGGGGGGGSSGGGAGGGRSSGTSVITSADHHMTTVPTPAQSLEGSCDSSSPSPSSTSGAAILPISVSVNRKNGANVPLGQDVFLDYCQKLLEKFRYPWELMPLMYVILKDADANIEEASRRIEEARVEINRTVAQIYYNYYTPMALVNGAPMYLTYPSIEQGRYGAHFTHLPLTQICPPTPEPLALSRSPSSPSGPSAVHNQKPSRPGSSNGTVHSAASPTMVTTMATTSSTPTLSRRQRSRSATPTTPPPPPPAHSSSNGAYHHGHHLVSSTAAT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of DSX_DROME !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DSX_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DSX_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DSX_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
XPO2_DROME | Cas | physical | 14605208 | |
ATPB_DROME | ATPsyn-beta | physical | 14605208 | |
SLEL_DROME | CG12592 | physical | 14605208 | |
UBP7_DROME | Usp7 | physical | 14605208 | |
TSG_DROME | tsg | physical | 14605208 | |
MS84D_DROME | Mst84Dd | physical | 14605208 | |
MS84C_DROME | Mst84Dc | physical | 14605208 | |
MS84A_DROME | Mst84Da | physical | 14605208 | |
RS15A_DROME | RpS15Aa | physical | 14605208 | |
UZIP_DROME | uzip | physical | 14605208 | |
TAMO_DROME | tamo | physical | 14605208 | |
DORS_DROME | dl | physical | 14605208 | |
LAMB1_DROME | LanB1 | physical | 14605208 | |
PPN_DROME | Ppn | physical | 14605208 | |
DSX_DROME | dsx | physical | 8978051 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...