| UniProt ID | DSX_DROME | |
|---|---|---|
| UniProt AC | P23023 | |
| Protein Name | Protein doublesex | |
| Gene Name | dsx | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 549 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Controls somatic sexual differentiation. Binds directly and specifically to the FBE (fat body enhancer) of the yolk protein 1 and 2 genes (Yp1 and Yp2). This enhancer is sufficient to direct the female-specific transcription characteristic of the Yp genes in adult fat bodies. Involved in regulation of male-specific expression of takeout in brain-associated fat body.. | |
| Protein Sequence | MVSEENWNSDTMSDSDMIDSKNDVCGGASSSSGSSISPRTPPNCARCRNHGLKITLKGHKRYCKFRYCTCEKCRLTADRQRVMALQTALRRAQAQDEQRALHMHEVPPANPAATTLLSHHHHVAAPAHVHAHHVHAHHAHGGHHSHHGHVLHHQQAAAAAAAAPSAPASHLGGSSTAASSIHGHAHAHHVHMAAAAAASVAQHQHQSHPHSHHHHHQNHHQHPHQQPATQTALRSPPHSDHGGSVGPATSSSGGGAPSSSNAAAATSSNGSSGGGGGGGGGSSGGGAGGGRSSGTSVITSADHHMTTVPTPAQSLEGSCDSSSPSPSSTSGAAILPISVSVNRKNGANVPLGQDVFLDYCQKLLEKFRYPWELMPLMYVILKDADANIEEASRRIEEARVEINRTVAQIYYNYYTPMALVNGAPMYLTYPSIEQGRYGAHFTHLPLTQICPPTPEPLALSRSPSSPSGPSAVHNQKPSRPGSSNGTVHSAASPTMVTTMATTSSTPTLSRRQRSRSATPTTPPPPPPAHSSSNGAYHHGHHLVSSTAAT | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of DSX_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DSX_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DSX_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DSX_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| XPO2_DROME | Cas | physical | 14605208 | |
| ATPB_DROME | ATPsyn-beta | physical | 14605208 | |
| SLEL_DROME | CG12592 | physical | 14605208 | |
| UBP7_DROME | Usp7 | physical | 14605208 | |
| TSG_DROME | tsg | physical | 14605208 | |
| MS84D_DROME | Mst84Dd | physical | 14605208 | |
| MS84C_DROME | Mst84Dc | physical | 14605208 | |
| MS84A_DROME | Mst84Da | physical | 14605208 | |
| RS15A_DROME | RpS15Aa | physical | 14605208 | |
| UZIP_DROME | uzip | physical | 14605208 | |
| TAMO_DROME | tamo | physical | 14605208 | |
| DORS_DROME | dl | physical | 14605208 | |
| LAMB1_DROME | LanB1 | physical | 14605208 | |
| PPN_DROME | Ppn | physical | 14605208 | |
| DSX_DROME | dsx | physical | 8978051 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
