TSG_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TSG_DROME
• UniProt AC: P54356
• Protein Name: Protein twisted gastrulation
• Gene Name: tsg
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 249
• Subcellular Localization: Secreted.
• Protein Description: Involved in dorsal-ventral patterning. Required for specification of a narrow strip of dorsal midline cells that will give rise to the amnioserosa, but not for specification of dorsal ectoderm cells. Inhibits BMP signaling; enhances the binding of sog to dpp, thus enhancing the antagonistic activity of sog..
• Protein Sequence: MQLLCYFVILFVGIAPWSSLANDDGCNEVVCGSVVSKCLITQSCQCKLNDCHCCKDCLNCLGELYIECCGCLDMCPKHKDVLPSLTPRSEIGDIEGVPELFDTLTAEDDEGWSTIRFSMRAGFKQRVQGGASGDAGNGNGNGNAGSAGVTLCTVIYVNSCIRANKCRQQCESMGASSYRWFHDGCCECVGENCLNYGINESRCRGCPEDQDQLLTADTVPAEAEQDLERFFGNEEIEDEWGYGEEDEFS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
84	Phosphorylation	KHKDVLPSLTPRSEI CCCCCCCCCCCHHHC	40.49	22817900
199	N-linked_Glycosylation	NCLNYGINESRCRGC CHHHHCCCCHHCCCC	36.51	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TSG_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TSG_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TSG_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
EF2_DROME	EF2	physical	14605208
SIR4_DROME	Sirt4	physical	14605208
SOG_DROME	sog	genetic	10769238
SOG_DROME	sog	physical	10769238

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.