dbPTM

MS84C_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MS84C_DROME
UniProt AC	Q01644
Protein Name	Male-specific sperm protein Mst84Dc
Gene Name	Mst84Dc
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	55
Subcellular Localization
Protein Description
Protein Sequence	MCCGPCGSCCGYYCCGPCCGPCGPRCGPCGSCCGPCGPCGPCCGPFGSCCGGCWC

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of MS84C_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MS84C_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MS84C_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MS84C_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HEMH_DROME	FeCH	physical	14605208
GSC_DROME	Gsc	physical	14605208
SIR4_DROME	Sirt4	physical	14605208
CPSF4_DROME	Clp	physical	14605208
RNK_DROME	CG40127	physical	14605208
RS16_DROME	RpS16	physical	14605208
SLOU_DROME	slou	physical	14605208
SRP09_DROME	Srp9	physical	14605208
DISC_DROME	disco	physical	14605208

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MS84C_DROME

Related Literatures of Post-Translational Modification