dbPTM

CPSF4_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CPSF4_DROME
UniProt AC	Q9VPT8
Protein Name	Cleavage and polyadenylation specificity factor subunit 4 {ECO:0000250\|UniProtKB:O95639}
Gene Name	Clp
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	296
Subcellular Localization	Nucleus .
Protein Description	Component of the cleavage and polyadenylation specificity factor (CPSF) complex that plays a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. Has endonuclease activity. Binds RNA polymers with a preference for G- and/or C-rich clusters. Binds single-stranded DNA non-specifically..
Protein Sequence	MDILLANVSGLQFKAERDLIEQVGAIPLPFYGMDKSIAAVCNFITRNGQECDKGSACPFRHIRGDRTIVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSRFNACHNKECPFLHIDPQSKVKDCPWYKRGFCRHGPHCRHQHLRRVLCMDYLAGFCPEGPSCKHMHPHFELPPLAELGKDQLHKKLPTCHYCGELGHKANSCKQYVGSLEHRNNINAMDHSGGHSGGYSGHSGHIEGADDMQSNHHSQPHGPGFVKVPTPLEEITCYKCGNKGHYANKCPKGHLAFLSNQHSHK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
294	Phosphorylation	AFLSNQHSHK----- HHHCCCCCCC-----		21082442

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CPSF4_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CPSF4_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CPSF4_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CPSF4_DROME

Related Literatures of Post-Translational Modification