dbPTM

HEMH_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	HEMH_DROME
UniProt AC	Q9V9S8
Protein Name	Ferrochelatase, mitochondrial
Gene Name	FeCh
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	384
Subcellular Localization	Mitochondrion inner membrane Peripheral membrane protein Matrix side.
Protein Description	Catalyzes the ferrous insertion into protoporphyrin IX..
Protein Sequence	MFLHNTKFCRLASGLAGGVRNLSGQKPKTAILMLNMGGPTHTDQVHDYLLRIMTDRDMIQLPVQSRLGPWIAQRRTPEVQKKYKEIGGGSPILKWTELQGQLMCEQLDRISPETAPHKHYVGFRYVNPLTENTLAEIEKDKPERVVLFSQYPQYSCATSGSSFNSIFTHYRSNNLPSDIKWSIIDRWGTHPLLIKTFAQRIRDELAKFVETKRNDVVILFTAHSLPLKAVNRGDAYPSEIGASVHMVMQELGQTNPYSLAWQSKVGPLPWLAPATDDAIKGYVKQGLKNFILVPIAFVNEHIETLHELDIEYCDELAKEVGVEEIRRAATPNDHPLFIDALTNVVADHLKSQQAVNPKFLMRCPMCSNPKCRESKSWYRQLCSN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
200	Ubiquitination	LIKTFAQRIRDELAK HHHHHHHHHHHHHHH	23.60	31113955
358	Ubiquitination	SQQAVNPKFLMRCPM HCCCCCHHHHHCCCC	46.02	31113955

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of HEMH_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of HEMH_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of HEMH_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of HEMH_DROME !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of HEMH_DROME

Related Literatures of Post-Translational Modification