dbPTM

MS84A_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MS84A_DROME
UniProt AC	Q01642
Protein Name	Male-specific sperm protein Mst84Da
Gene Name	Mst84Da
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	63
Subcellular Localization
Protein Description
Protein Sequence	MYMYVNPNYVLVGGPCCGPCGGCGPCGGCGPCCGGCGPCCGPCGGCGPCCGGTSSFCGCGPCC

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of MS84A_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MS84A_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MS84A_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MS84A_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
KPC3_DROME	Pkc98E	physical	14605208
CPSF4_DROME	Clp	physical	14605208
GCM2_DROME	gcm2	physical	14605208
DPOA2_DROME	DNApol-alpha73	physical	14605208
MTA70_DROME	Ime4	physical	14605208
SLOU_DROME	slou	physical	14605208
UBCD4_DROME	UbcD4	physical	14605208

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MS84A_DROME

Related Literatures of Post-Translational Modification