| UniProt ID | PP12_DROME | |
|---|---|---|
| UniProt AC | P12982 | |
| Protein Name | Serine/threonine-protein phosphatase alpha-2 isoform | |
| Gene Name | Pp1-87B | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 302 | |
| Subcellular Localization | Cytoplasm. | |
| Protein Description | Is essential for the regulation of mitotic chromosomal segregation as well as regulation of chromatin condensation during interphase.. | |
| Protein Sequence | MGDVMNIDSIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGFYDECKRRYSIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLQKHEFDLICRAHQVVEDGYEFFAKRMLVTLFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADKRKK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 46 | Phosphorylation | KSREIFLSQPILLEL CCCHHHHCCCEEEEE | 24.14 | 22817900 | |
| 139 | Ubiquitination | YGFYDECKRRYSIKL EEECHHHHHHHEEEE | 37.55 | 31113955 | |
| 236 | Acetylation | VVAKFLQKHEFDLIC HHHHHHHHCCCCEEE | 47.45 | 21791702 | |
| 258 | Acetylation | DGYEFFAKRMLVTLF HCHHHHHHHHHHHHH | 32.93 | 21791702 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PP12_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PP12_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PP12_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PP11_DROME | Pp1alpha-96A | genetic | 17513890 | |
| PP1B_DROME | flw | genetic | 17513890 | |
| SQH_DROME | sqh | physical | 15269282 | |
| MOEH_DROME | Moe | physical | 26168397 | |
| KTU_DROME | Nop17l | physical | 17007873 | |
| MARS_DROME | mars | physical | 17007873 | |
| GBS76_DROME | Gbs-76A | physical | 17007873 | |
| TRX_DROME | trx | physical | 17007873 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
