UniProt ID | RL8_DROME | |
---|---|---|
UniProt AC | Q9V3G1 | |
Protein Name | 60S ribosomal protein L8 | |
Gene Name | RpL8 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 256 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | ||
Protein Sequence | MGRVIRAQRKGAGSVFKAHVKKRKGAAKLRSLDFAERSGYIRGVVKDIIHDPGRGAPLAVVHFRDPYRYKIRKELFIAPEGMHTGQFVYCGRKATLQIGNVMPLSQMPEGTIICNLEEKTGDRGRLARTSGNYATVIAHNQDTKKTRVKLPSGAKKVVPSANRAMVGIVAGGGRIDKPILKAGRAYHKYKVKRNSWPKVRGVAMNPVEHPHGGGNHQHIGKASTVKRGTSAGRKVGLIAARRTGRIRGGKGDSKDK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
31 | Phosphorylation | KGAAKLRSLDFAERS CCCHHHHCCCHHHHH | 42.60 | 19429919 | |
130 | Phosphorylation | RGRLARTSGNYATVI CCCEEECCCCEEEEE | 21.35 | 21082442 | |
181 | Acetylation | RIDKPILKAGRAYHK CCCHHHHHCCCEEEE | 49.90 | 21791702 | |
195 | Phosphorylation | KYKVKRNSWPKVRGV EEECCCCCCCCEEEE | 49.11 | 27626673 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL8_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL8_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL8_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
1433Z_DROME | 14-3-3zeta | physical | 14605208 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...