RL8_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RL8_DROME
• UniProt AC: Q9V3G1
• Protein Name: 60S ribosomal protein L8
• Gene Name: RpL8
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 256
• Subcellular Localization: Cytoplasm.
• Protein Sequence: MGRVIRAQRKGAGSVFKAHVKKRKGAAKLRSLDFAERSGYIRGVVKDIIHDPGRGAPLAVVHFRDPYRYKIRKELFIAPEGMHTGQFVYCGRKATLQIGNVMPLSQMPEGTIICNLEEKTGDRGRLARTSGNYATVIAHNQDTKKTRVKLPSGAKKVVPSANRAMVGIVAGGGRIDKPILKAGRAYHKYKVKRNSWPKVRGVAMNPVEHPHGGGNHQHIGKASTVKRGTSAGRKVGLIAARRTGRIRGGKGDSKDK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
31	Phosphorylation	KGAAKLRSLDFAERS CCCHHHHCCCHHHHH	42.60	19429919
130	Phosphorylation	RGRLARTSGNYATVI CCCEEECCCCEEEEE	21.35	21082442
181	Acetylation	RIDKPILKAGRAYHK CCCHHHHHCCCEEEE	49.90	21791702
195	Phosphorylation	KYKVKRNSWPKVRGV EEECCCCCCCCEEEE	49.11	27626673

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RL8_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RL8_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RL8_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
1433Z_DROME	14-3-3zeta	physical	14605208

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.