| UniProt ID | ACT3_DROME | |
|---|---|---|
| UniProt AC | P53501 | |
| Protein Name | Actin-57B | |
| Gene Name | Act57B | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 376 | |
| Subcellular Localization | Cytoplasm, cytoskeleton. | |
| Protein Description | Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.; Multiple isoforms are involved in various cellular functions such as cytoskeleton structure, cell mobility, chromosome movement and muscle contraction.. | |
| Protein Sequence | MCDDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPESLFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANIVMSGGTTMYPGIADRMQKEITSLAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPGIVHRKCF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 | Acetylation | -----MCDDEVAALV -----CCCCCCEEEE | 54.53 | - | |
| 34 | Phosphorylation | APRAVFPSIVGRPRH CCCCCCHHHCCCCCC | 20.59 | 22817900 | |
| 45 | Methionine sulfoxide | RPRHQGVMVGMGQKD CCCCCCEEEECCCCC | 2.49 | - | |
| 45 | Oxidation | RPRHQGVMVGMGQKD CCCCCCEEEECCCCC | 2.49 | 22116028 | |
| 48 | Methionine sulfoxide | HQGVMVGMGQKDSYV CCCEEEECCCCCCCC | 3.32 | - | |
| 48 | Oxidation | HQGVMVGMGQKDSYV CCCEEEECCCCCCCC | 3.32 | 22116028 | |
| 53 | Phosphorylation | VGMGQKDSYVGDEAQ EECCCCCCCCCCHHH | 28.84 | 21082442 | |
| 61 | Phosphorylation | YVGDEAQSKRGILTL CCCCHHHCCCCEEEE | 31.22 | 27794539 | |
| 67 | Phosphorylation | QSKRGILTLKYPIEH HCCCCEEEEECEECC | 21.20 | 22668510 | |
| 74 | Methylation | TLKYPIEHGIITNWD EEECEECCCCCCCHH | 33.21 | 30526847 | |
| 107 | Phosphorylation | EEHPVLLTEAPLNPK CCCCEEEEECCCCCC | 26.41 | 22817900 | |
| 241 | Phosphorylation | STSLEKSYELPDGQV HCCCHHHEECCCCCE | 32.33 | 29892262 | |
| 324 | Phosphorylation | EITSLAPSTIKIKII HHHHHCCCEEEEEEE | 36.84 | 27794539 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ACT3_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ACT3_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ACT3_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TAF12_DROME | Taf12 | physical | 14605208 | |
| PRS4_DROME | Rpt2 | physical | 14605208 | |
| WWOX_DROME | Wwox | physical | 14605208 | |
| EFHD2_DROME | Swip-1 | physical | 22036573 | |
| HYI_DROME | Gip | physical | 22036573 | |
| CAPZA_DROME | cpa | physical | 22036573 | |
| ARP2_DROME | Arp2 | physical | 22036573 | |
| TBB2_DROME | betaTub85D | physical | 22036573 | |
| CAPZB_DROME | cpb | physical | 22036573 | |
| OSGEP_DROME | CG4933 | physical | 22036573 | |
| SH3BG_DROME | Sh3beta | physical | 22036573 | |
| ARP3_DROME | Arp3 | physical | 22036573 | |
| NDKA_DROME | awd | physical | 22036573 | |
| ARPC2_DROME | Arpc2 | physical | 22036573 | |
| MYSA_DROME | Mhc | genetic | 25972811 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
