CAPZA_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CAPZA_DROME
• UniProt AC: Q9W2N0
• Protein Name: F-actin-capping protein subunit alpha
• Gene Name: cpa
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 286
• Protein Description: F-actin-capping proteins bind in a Ca(2+)-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments (By similarity)..
• Protein Sequence: MEQTPITDAEKVRIVSDFILHAPPGEFNEVFNDVRELLKNDTLLKDGASHAFAQYNKDQLTPVRIEGTDHNAIISEHNDLGNGRFYDPRTKQAFKYDHLRKEASDYQDVEADATAEPWRAALDLETLAYTASHYRHGVSSVFGKAQGNQITLTICIEDHQFQPKNYWNGRWRSQWHVTFQAGSGTAELKGVLKVQVHYYEDGNVQLVSSKECRESVVVSNEQQVAKEVIRLIEDAENEYQLAISENYQTMSDTTFKAMRRQLPITRTKIDWSKIVSYSIGKELKTQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
61	Phosphorylation	QYNKDQLTPVRIEGT HCCCCCCCCEEEECC	17.69	21082442
281	Acetylation	IVSYSIGKELKTQ-- HHHHHCCHHHCCC--	59.20	21791702

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CAPZA_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CAPZA_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CAPZA_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CAPZB_DROME	cpb	physical	14605208
ADRL_DROME	AdipoR	physical	14605208
VG_DROME	vg	genetic	16887822
DIAP1_DROME	th	genetic	16887822

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.