UniProt ID | EFHD2_DROME | |
---|---|---|
UniProt AC | Q9VJ26 | |
Protein Name | EF-hand domain-containing protein D2 homolog | |
Gene Name | Swip-1 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 217 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MSVSSNASSASNKDSVDSPSSTTNTDSSELTHILNRRQEIMESQEAGIEVRRTYKVVNVYTDFPEFSRNQIKDYQKTFNTYDTARDGFLDLQELKFMMEKLGAPQTHLGLKQMIAEVDEDNDGKISFREFLLIFRKAQAGELDSDSGLNQLARLTEVDVEQVGVSGAKNFFEAKIEQQLRTNKFHDEIRAEQEERRREEEERAQRRQQFQQRAAIFQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Phosphorylation | ---MSVSSNASSASN ---CCCCCCCCCCCC | 27794539 | ||
8 | Phosphorylation | MSVSSNASSASNKDS CCCCCCCCCCCCCCC | 27794539 | ||
9 | Phosphorylation | SVSSNASSASNKDSV CCCCCCCCCCCCCCC | 27794539 | ||
15 | Phosphorylation | SSASNKDSVDSPSST CCCCCCCCCCCCCCC | 19429919 | ||
18 | Phosphorylation | SNKDSVDSPSSTTNT CCCCCCCCCCCCCCC | 19429919 | ||
20 | Phosphorylation | KDSVDSPSSTTNTDS CCCCCCCCCCCCCCH | 19429919 | ||
21 | Phosphorylation | DSVDSPSSTTNTDSS CCCCCCCCCCCCCHH | 23607784 | ||
22 | Phosphorylation | SVDSPSSTTNTDSSE CCCCCCCCCCCCHHH | 23607784 | ||
23 | Phosphorylation | VDSPSSTTNTDSSEL CCCCCCCCCCCHHHH | 23607784 | ||
25 | Phosphorylation | SPSSTTNTDSSELTH CCCCCCCCCHHHHHH | 23607784 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EFHD2_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EFHD2_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EFHD2_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CAPZA_DROME | cpa | physical | 22036573 | |
ARPC2_DROME | Arpc2 | physical | 22036573 | |
GMPPB_DROME | CG1129 | physical | 22036573 | |
ELP4_DROME | CG6907 | physical | 25242320 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...