| UniProt ID | PRS4_DROME | |
|---|---|---|
| UniProt AC | P48601 | |
| Protein Name | 26S proteasome regulatory subunit 4 | |
| Gene Name | Rpt2 | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 439 | |
| Subcellular Localization | Cytoplasm. Nucleus. | |
| Protein Description | The 26S proteasome is involved in the ATP-dependent degradation of ubiquitinated proteins. The regulatory (or ATPase) complex confers ATP dependency and substrate specificity to the 26S complex (By similarity).. | |
| Protein Sequence | MGQNQSAQGGAGEKKDDKDKKKKYEPPIPTRVGKKKRRAKGPDAAMKLPQVTPHTRCRLKLLKLERIKDYLMMEDEFIRNQERLKPQDEKNEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAVVGVLSDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFTIHTSRMTLAEDVNLSELIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKESVLYRKKEGTPEGLYL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 433 | Phosphorylation | LYRKKEGTPEGLYL- HEECCCCCCCCCCC- | 21.18 | 19429919 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PRS4_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PRS4_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PRS4_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PSMD9_DROME | CG9588 | physical | 14605208 | |
| PRS8_DROME | Rpt6 | physical | 22036573 | |
| ADRM1_DROME | Rpn13 | physical | 22036573 | |
| PSA1_DROME | Prosalpha6 | physical | 22036573 | |
| PSA4_DROME | Prosalpha3 | physical | 22036573 | |
| PSB3_DROME | Prosbeta3 | physical | 22036573 | |
| PSA3_DROME | Prosalpha7 | physical | 22036573 | |
| PSMD1_DROME | Rpn2 | physical | 22036573 | |
| PSB4_DROME | Prosbeta7 | physical | 22036573 | |
| PSA5_DROME | Prosalpha5 | physical | 22036573 | |
| PSA2_DROME | Prosalpha2 | physical | 22036573 | |
| PSDE_DROME | Rpn11 | physical | 22036573 | |
| PSD11_DROME | Rpn6 | physical | 22036573 | |
| PSA6_DROME | Prosalpha1 | physical | 22036573 | |
| PSMD6_DROME | Rpn7 | physical | 22036573 | |
| PSMD3_DROME | Rpn3 | physical | 22036573 | |
| CCD1P_DROME | Cyp12d1-p | physical | 22036573 | |
| HLES_DROME | H | physical | 16410550 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
