UniProt ID | PSMD9_DROME | |
---|---|---|
UniProt AC | Q9VFS8 | |
Protein Name | 26S proteasome non-ATPase regulatory subunit 9 {ECO:0000250|UniProtKB:O00233} | |
Gene Name | CG9588 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 220 | |
Subcellular Localization | ||
Protein Description | Acts as a chaperone during the assembly of the 26S proteasome, specifically of the base subcomplex of the PA700/19S regulatory complex (RC).. | |
Protein Sequence | MAAGTTTKERLERLINAKKQLEAQINRNGQILAANDNVGMSGPLVDAEGFPRNDIDVYQVRLARQTIICLQNDHKELMNQIQTLLNQYHSEIATTDPELVNRASALDLDSDRSPGGANITDLAPARAIVVVNLVSPDSPAERAGLCAGDAILRFGSINSGNFKGDLAQIGELVRNMQSQNVQLKVKRGEQQLDLILVPKTWSGRGLLGCNIVLPPEAMDH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
104 | Phosphorylation | PELVNRASALDLDSD HHHHHHHHHCCCCCC | 19429919 | ||
110 | Phosphorylation | ASALDLDSDRSPGGA HHHCCCCCCCCCCCC | 19429919 | ||
113 | Phosphorylation | LDLDSDRSPGGANIT CCCCCCCCCCCCCHH | 19429919 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PSMD9_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PSMD9_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PSMD9_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PSMF1_DROME | PI31 | physical | 23622245 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...