PSA3_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PSA3_DROME
• UniProt AC: Q9V5C6
• Protein Name: Proteasome subunit alpha type-3
• Gene Name: Prosalpha7
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 253
• Subcellular Localization: Cytoplasm. Nucleus.
• Protein Description: The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity (By similarity)..
• Protein Sequence: MSTIGTGYDLSASQFSPDGRVFQIDYASKAVEKSGTVIGIRGKDAVVLAVEKIITSKLYEPDAGGRIFTIEKNIGMAVAGLVADGNFVADIARQEAANYRQQFEQAIPLKHLCHRVAGYVHAYTLYSAVRPFGLSIILASWDEVEGPQLYKIEPSGSSFGYFACASGKAKQLAKTEMEKLKMDMRTDELVESAGEIIYKVHDELKDKDFRFEMGLVGRVTGGLHLINPSELTEKARKAGDAANKDEDSDNETH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
174	Acetylation	GKAKQLAKTEMEKLK CHHHHHHHHHHHHHH	54.32	21791702
220	Phosphorylation	MGLVGRVTGGLHLIN CCCCEEECCCEEECC	24.95	22817900
248	Phosphorylation	AANKDEDSDNETH-- HCCCCCCCCCCCC--	40.04	19429919
252	Phosphorylation	DEDSDNETH------ CCCCCCCCC------	38.86	19429919

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PSA3_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PSA3_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PSA3_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PSA1_DROME	Prosalpha6	physical	14605208
PSA4_DROME	Prosalpha3	physical	22036573
PSA1_DROME	Prosalpha6	physical	22036573
PSB4_DROME	Prosbeta7	physical	22036573
PSA2_DROME	Prosalpha2	physical	22036573
PSA6_DROME	Prosalpha1	physical	22036573
PSB3_DROME	Prosbeta3	physical	22036573
PSMD1_DROME	Rpn2	physical	22036573
ADRM1_DROME	Rpn13	physical	22036573
PSDE_DROME	Rpn11	physical	22036573
TERA_DROME	TER94	physical	22036573
PSD11_DROME	Rpn6	physical	22036573
PSB2_DROME	Prosbeta4R2	physical	22036573
PSMD6_DROME	Rpn7	physical	22036573
C4G15_DROME	Cyp4g15	physical	22036573
SH3BG_DROME	Sh3beta	physical	22036573
PSMF1_DROME	PI31	physical	23622245

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"Phosphoproteome analysis of Drosophila melanogaster embryos.";
Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.;
J. Proteome Res. 7:1675-1682(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-248, AND MASSSPECTROMETRY.
PubMed: 18327897