PSB2_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PSB2_DROME
• UniProt AC: Q9VQE5
• Protein Name: Probable proteasome subunit beta type-2
• Gene Name: Prosbeta4R2
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 210
• Subcellular Localization: Cytoplasm . Nucleus.
• Protein Description: The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity (By similarity)..
• Protein Sequence: MAMETILGIKGPDFVMLASDTMQAKSLVFMKDDQSKIHRLSDFNMMATVGDGGDTIQFTDFISKNLHLYKISHGYHLSAKSAAHFTRKTLADYIRTNTRYQVAMLLAGYDAVEGPDLHYIDSYGAAQSINHAGHGWGSMFCGSILQRYWNSKLSQEDAYSLMKKCVLEIQRRLIINQRNFEVYVVDSKGMRKMEAINPGSLNKESISLSW

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
72	Phosphorylation	NLHLYKISHGYHLSA CCEEEEECCCEECCH	13.50	22817900
75	Phosphorylation	LYKISHGYHLSAKSA EEEECCCEECCHHHH	8.31	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PSB2_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PSB2_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PSB2_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PSA1_DROME	Prosalpha6	physical	22036573
PSA4_DROME	Prosalpha3	physical	22036573
PSB4_DROME	Prosbeta7	physical	22036573
PSA2_DROME	Prosalpha2	physical	22036573

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.