R10AB_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: R10AB_DROME
• UniProt AC: Q9VTP4
• Protein Name: 60S ribosomal protein L10a-2
• Gene Name: RpL10Ab
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 217
• Protein Sequence: MASKVSRDTLYEGVNGLLEASAKKKRGFLETVELQIGLKNYDPQKDKRFSGTVKLKHIPRPKMKVCILGDQQHCDEAKANNVDFMDAEALKKLNKNKKLVKKLAKSYDAFLASESLIKQIPRLLGPGLNKAGKFPALLSHQESMIGKIEEVKSTIKFQMKKVLCLSVAVGHVGMKSDELAQNVNLSINFLVSLLKKNWQNVRSLHVKSSMGPPQRLY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
50	Phosphorylation	PQKDKRFSGTVKLKH CCCCCCCCCEEECCC	37.27	22817900
91	Acetylation	FMDAEALKKLNKNKK CCCHHHHHHHHHCHH	63.36	21791702
118	Ubiquitination	LASESLIKQIPRLLG HHCHHHHHHHHHHHC	47.68	31113955
118	Acetylation	LASESLIKQIPRLLG HHCHHHHHHHHHHHC	47.68	21791702
130	Acetylation	LLGPGLNKAGKFPAL HHCCCCCCCCCCHHH	64.66	21791702
143	Phosphorylation	ALLSHQESMIGKIEE HHHCCCHHHCCCHHH	14.77	21082442

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of R10AB_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of R10AB_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of R10AB_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
DDX6_DROME	me31B	physical	25918245
EDC4_DROME	Ge-1	physical	25918245
CLU_DROME	clu	physical	26834020
PABP_DROME	pAbp	physical	25918245
RGA_DROME	Rga	physical	25918245
RS3_DROME	RpS3	physical	25918245
GAWKY_DROME	gw	physical	25918245
IF4E_DROME	eIF-4E	physical	25918245

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.