UniProt ID | R10AB_DROME | |
---|---|---|
UniProt AC | Q9VTP4 | |
Protein Name | 60S ribosomal protein L10a-2 | |
Gene Name | RpL10Ab | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 217 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MASKVSRDTLYEGVNGLLEASAKKKRGFLETVELQIGLKNYDPQKDKRFSGTVKLKHIPRPKMKVCILGDQQHCDEAKANNVDFMDAEALKKLNKNKKLVKKLAKSYDAFLASESLIKQIPRLLGPGLNKAGKFPALLSHQESMIGKIEEVKSTIKFQMKKVLCLSVAVGHVGMKSDELAQNVNLSINFLVSLLKKNWQNVRSLHVKSSMGPPQRLY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
50 | Phosphorylation | PQKDKRFSGTVKLKH CCCCCCCCCEEECCC | 37.27 | 22817900 | |
91 | Acetylation | FMDAEALKKLNKNKK CCCHHHHHHHHHCHH | 63.36 | 21791702 | |
118 | Ubiquitination | LASESLIKQIPRLLG HHCHHHHHHHHHHHC | 47.68 | 31113955 | |
118 | Acetylation | LASESLIKQIPRLLG HHCHHHHHHHHHHHC | 47.68 | 21791702 | |
130 | Acetylation | LLGPGLNKAGKFPAL HHCCCCCCCCCCHHH | 64.66 | 21791702 | |
143 | Phosphorylation | ALLSHQESMIGKIEE HHHCCCHHHCCCHHH | 14.77 | 21082442 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of R10AB_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of R10AB_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of R10AB_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DDX6_DROME | me31B | physical | 25918245 | |
EDC4_DROME | Ge-1 | physical | 25918245 | |
CLU_DROME | clu | physical | 26834020 | |
PABP_DROME | pAbp | physical | 25918245 | |
RGA_DROME | Rga | physical | 25918245 | |
RS3_DROME | RpS3 | physical | 25918245 | |
GAWKY_DROME | gw | physical | 25918245 | |
IF4E_DROME | eIF-4E | physical | 25918245 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...