UniProt ID | RS7_DROME | |
---|---|---|
UniProt AC | Q9VA91 | |
Protein Name | 40S ribosomal protein S7 | |
Gene Name | RpS7 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 194 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MAIGSKIIKPGGSDPDDFEKSIAQALVELEANSDLKPYLRDLHITRAREIEFGSKKAVIIYVPIPQQKVFQKIQIILVRELEKKFSGKHVVVIAERKILPKPTRKARNPLKQKRPRSRTLTAVYDAILEDLVFPAEIVGKRIRVKLDGSQLVKVHLDKNQQTTIEHKVDTFTSVYKKLTGRDVTFEFPDNYLNV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Acetylation | --MAIGSKIIKPGGS --CCCCCEECCCCCC | 43.15 | - | |
13 | Phosphorylation | KIIKPGGSDPDDFEK EECCCCCCCHHHHHH | 52.46 | 22668510 | |
88 | Acetylation | LEKKFSGKHVVVIAE HHHHHCCCEEEEEEE | 31.84 | - | |
153 | Acetylation | LDGSQLVKVHLDKNQ ECCCEEEEEEECCCC | 32.31 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RS7_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RS7_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RS7_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NOI_DROME | noi | physical | 14605208 | |
SAV_DROME | sav | physical | 14605208 | |
Y5057_DROME | CG45057 | physical | 14605208 | |
TF2AA_DROME | TfIIA-L | physical | 14605208 | |
ARCH_DROME | CG6353 | physical | 14605208 | |
DIMM_DROME | dimm | physical | 14605208 | |
RS27A_DROME | RpS27A | physical | 24292889 | |
CLU_DROME | clu | physical | 26834020 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...