UniProt ID | Y5057_DROME | |
---|---|---|
UniProt AC | Q9VV43 | |
Protein Name | TPPP family protein CG45057 | |
Gene Name | CG45057 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 192 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MSEVAAANGSPSPAPTPEVPATELAQLALEDEPKVSFSDQFKAFSKFGDSKSDGKLITLSQSDKWMKQAKVIDKKITTTDTGIHFKKFKAMKISLSDYNKFLDDLAKTKKVELSEIKQKLASCGAPGVVSVSAGKAAAAVDRLTDTSKYTGSHKERFDASGKGKGIAGRRNVVDGSGYVSGYQHKDTYDNAH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of Y5057_DROME !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of Y5057_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of Y5057_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of Y5057_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
VATG_DROME | Vha13 | physical | 14605208 | |
RS3_DROME | RpS3 | physical | 14605208 | |
MS2A_DROME | Acp26Aa | physical | 14605208 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...