UniProt ID | MS2A_DROME | |
---|---|---|
UniProt AC | P10333 | |
Protein Name | Accessory gland-specific peptide 26Aa | |
Gene Name | Acp26Aa | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 264 | |
Subcellular Localization | Secreted, extracellular space. | |
Protein Description | This protein is transferred from male to female's hemolymph during mating, affecting egglaying and behavior after mating.. | |
Protein Sequence | MNQILLCSPILLLLFTVASCDSEQQLDSAMHLKSDSTKSASLKNVAPKNDETQAKIAKDDVALKDAKKGDYIMDIDISDLPLDDYPINRSKSLKSSSIDLNNIPFNKGLDDFPAKEKNQGSNQSALKALQQRLLTEQNNSLLLRNHSIYLMKEIEARKTDIIKVRQLNLDLELELNTVNRRLLELNGQLQNTRKSTKPCKKRSSKDSAPPAANQFQEANVRNTYRNKYLTLLKELSQKINNEIAKVATDVPTETNPSQGNLPTL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
88 | N-linked_Glycosylation | PLDDYPINRSKSLKS CCCCCCCCCCCCCCC | 37.35 | - | |
122 | N-linked_Glycosylation | KEKNQGSNQSALKAL HHCCCCCCHHHHHHH | 46.80 | - | |
138 | N-linked_Glycosylation | QRLLTEQNNSLLLRN HHHHHHHCCCHHHHH | 33.55 | - | |
145 | N-linked_Glycosylation | NNSLLLRNHSIYLMK CCCHHHHHCCEEEEH | 32.97 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MS2A_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MS2A_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MS2A_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MS2A_DROME | Acp26Aa | physical | 20138215 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...