MS2A_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MS2A_DROME
• UniProt AC: P10333
• Protein Name: Accessory gland-specific peptide 26Aa
• Gene Name: Acp26Aa
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 264
• Subcellular Localization: Secreted, extracellular space.
• Protein Description: This protein is transferred from male to female's hemolymph during mating, affecting egglaying and behavior after mating..
• Protein Sequence: MNQILLCSPILLLLFTVASCDSEQQLDSAMHLKSDSTKSASLKNVAPKNDETQAKIAKDDVALKDAKKGDYIMDIDISDLPLDDYPINRSKSLKSSSIDLNNIPFNKGLDDFPAKEKNQGSNQSALKALQQRLLTEQNNSLLLRNHSIYLMKEIEARKTDIIKVRQLNLDLELELNTVNRRLLELNGQLQNTRKSTKPCKKRSSKDSAPPAANQFQEANVRNTYRNKYLTLLKELSQKINNEIAKVATDVPTETNPSQGNLPTL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
88	N-linked_Glycosylation	PLDDYPINRSKSLKS CCCCCCCCCCCCCCC	37.35	-
122	N-linked_Glycosylation	KEKNQGSNQSALKAL HHCCCCCCHHHHHHH	46.80	-
138	N-linked_Glycosylation	QRLLTEQNNSLLLRN HHHHHHHCCCHHHHH	33.55	-
145	N-linked_Glycosylation	NNSLLLRNHSIYLMK CCCHHHHHCCEEEEH	32.97	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MS2A_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MS2A_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MS2A_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MS2A_DROME	Acp26Aa	physical	20138215

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.