RL14_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RL14_DROME
• UniProt AC: P55841
• Protein Name: 60S ribosomal protein L14
• Gene Name: RpL14
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 166
• Protein Sequence: MPFERFVQTGRIAKASAGPLKGRLVAIVDVIDQNRVLVDGPLTGVPRQEYRLNNLHLTKYRIKFPYTAPTRIVRKAWTESDLKAQWKVSPWSVKAQNICKRSSLNDFDRFKLRYAKRQRNKLLTIAFNTLKKRTKADGTPRVLKKDRRERLRAEKAKGGKKAAAKK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
102	Phosphorylation	AQNICKRSSLNDFDR HHHHHHCCCCCHHHH	25.36	19429919
103	Phosphorylation	QNICKRSSLNDFDRF HHHHHCCCCCHHHHH	34.91	19429919
129	Phosphorylation	LLTIAFNTLKKRTKA HHHHHHHHHHHHHCC	33.24	21082442

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RL14_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RL14_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RL14_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ASF1_DROME	asf1	physical	14605208
GRK_DROME	grk	physical	23213441

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.