UniProt ID | RS6_DROME | |
---|---|---|
UniProt AC | P29327 | |
Protein Name | 40S ribosomal protein S6 | |
Gene Name | RpS6 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 248 | |
Subcellular Localization | ||
Protein Description | May play an important role in controlling cell growth and proliferation through the selective translation of particular classes of mRNA.. | |
Protein Sequence | MKLNVSYPATGCQKLFEVVDEHKLRVFYEKRMGQVVEADILGDEWKGYQLRIAGGNDKQGFPMKQGVLTHGRVRLLLKKGHSCYRPRRTGERKRKSVRGCIVDANMSVLALVVLKKGEKDIPGLTDTTIPRRLGPKRASKIRKLYNLSKEDDVRRFVVRRPLPAKDNKKATSKAPKIQRLITPVVLQRKHRRIALKKKRQIASKEASADYAKLLVQRKKESKAKREEAKRRRSASIRESKSSVSSDKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
143 | Acetylation | KRASKIRKLYNLSKE HHHHHHHHHHCCCCH | 59.81 | 21791702 | |
182 | Phosphorylation | PKIQRLITPVVLQRK HHHHHHHHHHHHHHH | 18.02 | 21082442 | |
204 | Acetylation | KKRQIASKEASADYA HHHHHHCHHHCHHHH | 48.56 | 21791702 | |
212 | Acetylation | EASADYAKLLVQRKK HHCHHHHHHHHHHHH | 35.80 | 21791702 | |
233 | Phosphorylation | EEAKRRRSASIRESK HHHHHHHHHHHHHHH | 25.26 | 19429919 | |
235 | Phosphorylation | AKRRRSASIRESKSS HHHHHHHHHHHHHHH | 24.35 | 19429919 | |
239 | Phosphorylation | RSASIRESKSSVSSD HHHHHHHHHHHCCCC | 28.17 | 19429919 | |
241 | Phosphorylation | ASIRESKSSVSSDKK HHHHHHHHHCCCCCC | 45.30 | 19429919 | |
242 | Phosphorylation | SIRESKSSVSSDKK- HHHHHHHHCCCCCC- | 29.74 | 19429919 | |
244 | Phosphorylation | RESKSSVSSDKK--- HHHHHHCCCCCC--- | 34.46 | 19429919 | |
245 | Phosphorylation | ESKSSVSSDKK---- HHHHHCCCCCC---- | 51.82 | 19429919 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RS6_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RS6_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RS6_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CP9F2_DROME | Cyp9f2 | physical | 14605208 | |
GNAS_DROME | Galphas | physical | 14605208 | |
NOL9_DROME | CG8414 | physical | 14605208 | |
RL22_DROME | RpL22 | physical | 24129492 | |
RL24_DROME | RpL24 | physical | 24129492 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-233; SER-235; SER-239;SER-242; SER-244 AND SER-245, AND MASS SPECTROMETRY. |