| UniProt ID | RL36_DROME | |
|---|---|---|
| UniProt AC | P49630 | |
| Protein Name | 60S ribosomal protein L36 | |
| Gene Name | RpL36 | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 115 | |
| Subcellular Localization | Cytoplasm, cytosol . Cytoplasm . Detected on cytosolic polysomes. | |
| Protein Description | Component of the large ribosomal subunit.. | |
| Protein Sequence | MAVRYELAIGLNKGHKTSKIRNVKYTGDKKVKGLRGSRLKNIQTRHTKFMRDLVREVVGHAPYEKRTMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNILTQLRKAQTHAK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 65 | Acetylation | VGHAPYEKRTMELLK HCCCCHHHHHHHHHH | 47.53 | 21791702 | |
| 72 | Acetylation | KRTMELLKVSKDKRA HHHHHHHHHCCCHHH | 58.02 | 21791702 | |
| 81 | Acetylation | SKDKRALKFLKRRLG CCCHHHHHHHHHHHH | 47.90 | 19608861 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL36_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL36_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL36_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...