UniProt ID | KAPC_DROME | |
---|---|---|
UniProt AC | P12370 | |
Protein Name | cAMP-dependent protein kinase catalytic subunit | |
Gene Name | Pka-C1 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 353 | |
Subcellular Localization | ||
Protein Description | Serine/threonine-protein kinase involved in memory formation. Promotes long-term memory by phosphorylating meng and by regulating CrebB protein stability and activity.. | |
Protein Sequence | MGNNATTSNKKVDAAETVKEFLEQAKEEFEDKWRRNPTNTAALDDFERIKTLGTGSFGRVMIVQHKPTKDYYAMKILDKQKVVKLKQVEHTLNEKRILQAIQFPFLVSLRYHFKDNSNLYMVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQGYLKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFGSDLKDLLRNLLQVDLTKRYGNLKAGVNDIKNQKWFASTDWIAIFQKKIEAPFIPRCKGPGDTSNFDDYEEEALRISSTEKCAKEFAEF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of KAPC_DROME !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KAPC_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KAPC_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KAPC_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CNN_DROME | cnn | physical | 14605208 | |
KAPR2_DROME | Pka-R2 | physical | 22036573 | |
FUSED_DROME | fu | physical | 22036573 | |
DECA_DROME | dpp | genetic | 7867063 | |
DECA_DROME | dpp | genetic | 10049571 | |
WNTG_DROME | wg | genetic | 7867063 | |
KAPR1_DROME | Pka-R1 | genetic | 10224260 | |
CI_DROME | ci | genetic | 11454764 | |
PANG1_DROME | pan | genetic | 11504926 | |
PANG2_DROME | pan | genetic | 11504926 | |
FUSED_DROME | fu | physical | 25289679 | |
SMO_DROME | smo | physical | 25289679 | |
COS_DROME | cos | physical | 25289679 | |
CI_DROME | ci | physical | 25289679 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...