| UniProt ID | KAPC_DROME | |
|---|---|---|
| UniProt AC | P12370 | |
| Protein Name | cAMP-dependent protein kinase catalytic subunit | |
| Gene Name | Pka-C1 | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 353 | |
| Subcellular Localization | ||
| Protein Description | Serine/threonine-protein kinase involved in memory formation. Promotes long-term memory by phosphorylating meng and by regulating CrebB protein stability and activity.. | |
| Protein Sequence | MGNNATTSNKKVDAAETVKEFLEQAKEEFEDKWRRNPTNTAALDDFERIKTLGTGSFGRVMIVQHKPTKDYYAMKILDKQKVVKLKQVEHTLNEKRILQAIQFPFLVSLRYHFKDNSNLYMVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQGYLKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFGSDLKDLLRNLLQVDLTKRYGNLKAGVNDIKNQKWFASTDWIAIFQKKIEAPFIPRCKGPGDTSNFDDYEEEALRISSTEKCAKEFAEF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of KAPC_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KAPC_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KAPC_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KAPC_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CNN_DROME | cnn | physical | 14605208 | |
| KAPR2_DROME | Pka-R2 | physical | 22036573 | |
| FUSED_DROME | fu | physical | 22036573 | |
| DECA_DROME | dpp | genetic | 7867063 | |
| DECA_DROME | dpp | genetic | 10049571 | |
| WNTG_DROME | wg | genetic | 7867063 | |
| KAPR1_DROME | Pka-R1 | genetic | 10224260 | |
| CI_DROME | ci | genetic | 11454764 | |
| PANG1_DROME | pan | genetic | 11504926 | |
| PANG2_DROME | pan | genetic | 11504926 | |
| FUSED_DROME | fu | physical | 25289679 | |
| SMO_DROME | smo | physical | 25289679 | |
| COS_DROME | cos | physical | 25289679 | |
| CI_DROME | ci | physical | 25289679 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
