UniProt ID | RL15_DROME | |
---|---|---|
UniProt AC | O17445 | |
Protein Name | 60S ribosomal protein L15 | |
Gene Name | RpL15 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 204 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MGAYRYMQELYRKKQSDVMRYLLRIRVWQYRQLTKLHRSPRPTRPDKARRLGYRAKQGFVIYRIRVRRGGRKRPVPKGCTYGKPKSHGVNQLKPYRGLQSIAEERVGRRLGGLRVLNSYWIAQDASYKYFEVILIDTHHSAIRRDPKINWICKHVHKHRELRGLTSAGKSSRGIGKGYRYSQTIGGSRRAAWKRKNREHMHRKR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL15_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL15_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL15_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MFRN_DROME | mfrn | physical | 14605208 | |
ARRA_DROME | Arr1 | physical | 14605208 | |
DORS_DROME | dl | physical | 14605208 | |
SHRM_DROME | Shroom | physical | 14605208 | |
HP1_DROME | Su(var)205 | genetic | 15687284 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...