| UniProt ID | RS2_DROME | |
|---|---|---|
| UniProt AC | P31009 | |
| Protein Name | 40S ribosomal protein S2 | |
| Gene Name | RpS2 | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 267 | |
| Subcellular Localization | ||
| Protein Description | Has a specific developmental role during oogenesis and a general role in protein synthesis as a component of the small ribosomal subunit.. | |
| Protein Sequence | MADEAPARSGFRGGFGSRGGRGGRGRGRGRWARGRGKEDSKEWVPVTKLGRLVREGKIKSLEEIYLYSLPIKEFEIIDFFLGSSLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLSVVPVRRGYWGNKIGKPHTVPCKVTGKCGSVSVRLIPAPRGTGIVSAPVPKKLLTMAGIEDCYTSARGSTGTLGNFAKATYAAIAKTYAYLTPDLWKEMPLGSTPYQAYSDFLSKPTPRLHADA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 60 | Phosphorylation | VREGKIKSLEEIYLY HHCCCCCCHHEEEEE | 44.48 | 19429919 | |
| 65 | Phosphorylation | IKSLEEIYLYSLPIK CCCHHEEEEEECCCC | 11.67 | 22817900 | |
| 97 | Acetylation | LKIMPVQKQTRAGQR HHHCCCCCCCCCCCC | 54.60 | 21791702 | |
| 249 | Phosphorylation | MPLGSTPYQAYSDFL CCCCCCCCHHHHHHH | 13.08 | 18281928 | |
| 252 | Phosphorylation | GSTPYQAYSDFLSKP CCCCCHHHHHHHCCC | 8.01 | 21082442 | |
| 253 | Phosphorylation | STPYQAYSDFLSKPT CCCCHHHHHHHCCCC | 25.54 | 21082442 | |
| 257 | Phosphorylation | QAYSDFLSKPTPRLH HHHHHHHCCCCCCCC | 36.26 | 21082442 | |
| 260 | Phosphorylation | SDFLSKPTPRLHADA HHHHCCCCCCCCCCC | 25.44 | 21082442 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RS2_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RS2_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RS2_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| FL2D_DROME | fl(2)d | physical | 14605208 | |
| DORS_DROME | dl | physical | 14605208 | |
| DYM_DROME | CG8230 | physical | 14605208 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...