UniProt ID | RS2_DROME | |
---|---|---|
UniProt AC | P31009 | |
Protein Name | 40S ribosomal protein S2 | |
Gene Name | RpS2 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 267 | |
Subcellular Localization | ||
Protein Description | Has a specific developmental role during oogenesis and a general role in protein synthesis as a component of the small ribosomal subunit.. | |
Protein Sequence | MADEAPARSGFRGGFGSRGGRGGRGRGRGRWARGRGKEDSKEWVPVTKLGRLVREGKIKSLEEIYLYSLPIKEFEIIDFFLGSSLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLSVVPVRRGYWGNKIGKPHTVPCKVTGKCGSVSVRLIPAPRGTGIVSAPVPKKLLTMAGIEDCYTSARGSTGTLGNFAKATYAAIAKTYAYLTPDLWKEMPLGSTPYQAYSDFLSKPTPRLHADA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
60 | Phosphorylation | VREGKIKSLEEIYLY HHCCCCCCHHEEEEE | 44.48 | 19429919 | |
65 | Phosphorylation | IKSLEEIYLYSLPIK CCCHHEEEEEECCCC | 11.67 | 22817900 | |
97 | Acetylation | LKIMPVQKQTRAGQR HHHCCCCCCCCCCCC | 54.60 | 21791702 | |
249 | Phosphorylation | MPLGSTPYQAYSDFL CCCCCCCCHHHHHHH | 13.08 | 18281928 | |
252 | Phosphorylation | GSTPYQAYSDFLSKP CCCCCHHHHHHHCCC | 8.01 | 21082442 | |
253 | Phosphorylation | STPYQAYSDFLSKPT CCCCHHHHHHHCCCC | 25.54 | 21082442 | |
257 | Phosphorylation | QAYSDFLSKPTPRLH HHHHHHHCCCCCCCC | 36.26 | 21082442 | |
260 | Phosphorylation | SDFLSKPTPRLHADA HHHHCCCCCCCCCCC | 25.44 | 21082442 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RS2_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RS2_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RS2_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
FL2D_DROME | fl(2)d | physical | 14605208 | |
DORS_DROME | dl | physical | 14605208 | |
DYM_DROME | CG8230 | physical | 14605208 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...