| UniProt ID | RING2_MOUSE | |
|---|---|---|
| UniProt AC | Q9CQJ4 | |
| Protein Name | E3 ubiquitin-protein ligase RING2 | |
| Gene Name | Rnf2 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 336 | |
| Subcellular Localization | Nucleus . Chromosome . Enriched on inactive X chromosome (Xi) in female trophoblast stem (TS) cells as well as differentiating embryonic stem (ES) cells. The enrichment on Xi is transient during TS and ES cell differentiation. The association with Xi | |
| Protein Description | E3 ubiquitin-protein ligase that mediates monoubiquitination of 'Lys-119' of histone H2A (H2AK119Ub), thereby playing a central role in histone code and gene regulation. [PubMed: 15525528] | |
| Protein Sequence | MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAVAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSQAVQTNG ------CCCCCCCCC | 27.18 | - | |
| 2 | Phosphorylation | ------MSQAVQTNG ------CCCCCCCCC | 27.18 | 24759943 | |
| 10 | Phosphorylation | QAVQTNGTQPLSKTW CCCCCCCCCCCCCCE | 29.14 | 24759943 | |
| 27 | Phosphorylation | SLYELQRTPQEAITD EHHHCCCCHHHHHCC | 19.16 | 27717184 | |
| 33 | Phosphorylation | RTPQEAITDGLEIVV CCHHHHHCCCCEEEE | 30.94 | 28285833 | |
| 41 | Phosphorylation | DGLEIVVSPRSLHSE CCCEEEECCCHHCHH | 12.05 | 27087446 | |
| 112 | Ubiquitination | NFDALISKIYPSRDE CHHHHHHHHCCCHHH | 38.99 | - | |
| 141 | Phosphorylation | HNNQQALSHSIEEGL HCCHHHHHHCHHHHH | 20.43 | 29550500 | |
| 143 | Phosphorylation | NQQALSHSIEEGLKI CHHHHHHCHHHHHHH | 28.46 | 22817900 | |
| 168 | Phosphorylation | KQQIENGSGAEDNGD HHHCCCCCCCCCCCC | 46.54 | 25159016 | |
| 176 | Phosphorylation | GAEDNGDSSHCSNAS CCCCCCCCCCCCCCC | 24.31 | 25168779 | |
| 177 | Phosphorylation | AEDNGDSSHCSNAST CCCCCCCCCCCCCCC | 33.00 | 25168779 | |
| 180 | Phosphorylation | NGDSSHCSNASTHSN CCCCCCCCCCCCCCC | 29.97 | 25168779 | |
| 183 | Phosphorylation | SSHCSNASTHSNQEA CCCCCCCCCCCCCCC | 30.79 | 25168779 | |
| 184 | Phosphorylation | SHCSNASTHSNQEAG CCCCCCCCCCCCCCC | 27.24 | 27087446 | |
| 186 | Phosphorylation | CSNASTHSNQEAGPS CCCCCCCCCCCCCCC | 40.05 | 27087446 | |
| 193 | Phosphorylation | SNQEAGPSNKRTKTS CCCCCCCCCCCCCCC | 54.81 | 25168779 | |
| 199 | Phosphorylation | PSNKRTKTSDDSGLE CCCCCCCCCCCCCCC | 36.45 | 26643407 | |
| 200 | Phosphorylation | SNKRTKTSDDSGLEL CCCCCCCCCCCCCCC | 40.76 | 26643407 | |
| 203 | Phosphorylation | RTKTSDDSGLELDNN CCCCCCCCCCCCCCC | 50.71 | 26643407 | |
| 224 | Phosphorylation | DPVMDGASEIELVFR EEECCCCCEEEEEEE | 44.64 | 26643407 |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RING2_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RING2_MOUSE !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
