CBX7_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CBX7_MOUSE
• UniProt AC: Q8VDS3
• Protein Name: Chromobox protein homolog 7
• Gene Name: Cbx7
• Organism: Mus musculus (Mouse).
• Sequence Length: 158
• Subcellular Localization: Nucleus . Chromosome . Requires trimethylation at 'Lys-27' (H3K27me3) for the localization to chromatin (PubMed:22226355). Localizes to facultative heterochromatin and to the inactivated X chromosome in females (PubMed:16537902).
• Protein Description: Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. [PubMed: 16537902]
• Protein Sequence: MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPRRLLLQESAAPDVVQTPGDWEPMEQAPEEEAEADLTNGPPPWTPTLPSSEVTVTDITANSVTVTFREAQAAEGFFRDRNEKL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
15	Phosphorylation	EQVFAVESIRKKRVR HEEEEHHHHHHHHCC	22.54	26643407
119	Phosphorylation	TNGPPPWTPTLPSSE CCCCCCCCCCCCCCE	16.51	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
119	T	Phosphorylation	Kinase	MAPK1	P28482	GPS
119	T	Phosphorylation	Kinase	MAPK3	P27361	GPS
119	T	Phosphorylation	Kinase	MAPK9	P45984	GPS
119	T	Phosphorylation	Kinase	MAPK10	P53779	GPS

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CBX7_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CBX7_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
H33_MOUSE	H3f3a	physical	16537902
PCGF2_MOUSE	Pcgf2	physical	22325148
RING1_MOUSE	Ring1	physical	22325148
PCGF6_MOUSE	Pcgf6	physical	22325148
RING2_MOUSE	Rnf2	physical	22325148
BMI1_HUMAN	BMI1	physical	26496610
E2F6_HUMAN	E2F6	physical	26496610
PHC2_HUMAN	PHC2	physical	26496610
RING1_HUMAN	RING1	physical	26496610
RING2_HUMAN	RNF2	physical	26496610
TAF12_HUMAN	TAF12	physical	26496610
TTC1_HUMAN	TTC1	physical	26496610
PSME3_HUMAN	PSME3	physical	26496610
SCML2_HUMAN	SCML2	physical	26496610
MGAP_HUMAN	MGA	physical	26496610
BCOR_HUMAN	BCOR	physical	26496610
CBX8_HUMAN	CBX8	physical	26496610
FBRS_HUMAN	FBRS	physical	26496610
GHC1_HUMAN	SLC25A22	physical	26496610
PHC3_HUMAN	PHC3	physical	26496610
PCGF6_HUMAN	PCGF6	physical	26496610
RRFM_HUMAN	MRRF	physical	26496610

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.