MED4_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MED4_MOUSE
• UniProt AC: Q9CQA5
• Protein Name: Mediator of RNA polymerase II transcription subunit 4
• Gene Name: Med4
• Organism: Mus musculus (Mouse).
• Sequence Length: 270
• Subcellular Localization: Nucleus.
• Protein Description: Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity)..
• Protein Sequence: MAASSSGEKEKERMGGVSGMAGLGSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQLEEENQVLELLIHRDGDFQELMKLALNQGKVHHEMQALEKEVEKRDSDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTSGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMSVNMLPPNHSSDFLLEPPGHNKENEDDVEVMSTDSSSSSSDSD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAASSSGEK ------CCCCCCCHH	18.95	-
25	Phosphorylation	SGMAGLGSTRERLLS CCHHCCCHHHHHHHH	29.36	29899451
27	Methylation	MAGLGSTRERLLSAL HHCCCHHHHHHHHHH	28.83	18967087
32	Phosphorylation	STRERLLSALEDLEV HHHHHHHHHHHHHHH	35.09	26745281
51	Phosphorylation	LIEMLAISRNQKLLQ HHHHHHHHCCCHHHH	21.41	28066266
105	Phosphorylation	KEVEKRDSDIQQLQK HHHHHHHHHHHHHHH	40.42	29550500
134	Phosphorylation	QAKEKLKSIEKARKG HHHHHHHHHHHHHCC	46.55	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MED4_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MED4_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MED4_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of MED4_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.