UniProt ID | CSK2B_MOUSE | |
---|---|---|
UniProt AC | P67871 | |
Protein Name | Casein kinase II subunit beta | |
Gene Name | Csnk2b | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 215 | |
Subcellular Localization | ||
Protein Description | Plays a complex role in regulating the basal catalytic activity of the alpha subunit (By similarity). Participates in Wnt signaling.. | |
Protein Sequence | MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSSSEEVSW ------CCCHHHHHH | 42.44 | - | |
2 | Phosphorylation | ------MSSSEEVSW ------CCCHHHHHH | 42.44 | 25293948 | |
3 | Phosphorylation | -----MSSSEEVSWI -----CCCHHHHHHH | 40.23 | 23649490 | |
4 | Phosphorylation | ----MSSSEEVSWIS ----CCCHHHHHHHH | 30.39 | 23649490 | |
8 | Phosphorylation | MSSSEEVSWISWFCG CCCHHHHHHHHHHHC | 23.21 | 25293948 | |
11 | Phosphorylation | SEEVSWISWFCGLRG HHHHHHHHHHHCCCC | 14.08 | 21743459 | |
37 | Phosphorylation | IQDKFNLTGLNEQVP HHHHHCCCCHHCCCC | 40.50 | - | |
69 | Phosphorylation | LEDNPNQSDLIEQAA HCCCCCHHHHHHHHH | 40.81 | - | |
108 | Phosphorylation | YQQGDFGYCPRVYCE HHCCCCCCCCEEEEC | 10.16 | 22817900 | |
191 | Ubiquitination | VPRLYGFKIHPMAYQ CCHHHCCEEECCCHH | 35.42 | 22790023 | |
197 | Phosphorylation | FKIHPMAYQLQLQAA CEEECCCHHHHHHHH | 11.96 | 25159016 | |
205 | Phosphorylation | QLQLQAASNFKSPVK HHHHHHHHCCCCCCC | 45.90 | 26824392 | |
208 | Ubiquitination | LQAASNFKSPVKTIR HHHHHCCCCCCCCCC | 59.09 | 22790023 | |
209 | Phosphorylation | QAASNFKSPVKTIR- HHHHCCCCCCCCCC- | 30.68 | 25521595 | |
212 | Acetylation | SNFKSPVKTIR---- HCCCCCCCCCC---- | 41.43 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CSK2B_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CSK2B_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CSK2B_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TC1D3_MOUSE | Tcte3 | physical | 12849985 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...