CENPV_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CENPV_MOUSE
• UniProt AC: Q9CXS4
• Protein Name: Centromere protein V
• Gene Name: Cenpv
• Organism: Mus musculus (Mouse).
• Sequence Length: 252
• Subcellular Localization: Chromosome, centromere, kinetochore . Nucleus . Cytoplasm, cytoskeleton, spindle . Enriched at the nuclear periphery and around the nucleolus. In mitotic cells, localizes to kinetochores from prometaphase to metaphase. At anaphase onset, transfers to
• Protein Description: Required for distribution of pericentromeric heterochromatin in interphase nuclei and for centromere formation and organization, chromosome alignment and cytokinesis..
• Protein Sequence: MRRTRSAVATGPREQRRSGATGGLSGGESRAQRSRSRTRAGAGGGGGAVGPQPSAKPRPKPPPRAQEAAAEEPPPAVTPAASVSALDLGEQRERWETFQKRQRLSFEGAAKLLLDTFEYQGLVKHTGGCHCGAVRFEVWASADLHIFDCNCSICKKKQNRHFIVPASRFKLLKGAESITTYTFNTHKAQHTFCKRCGVQSFYTPRSNPGGFGIAPHCLDEGTVRSVVTEEFNGSDWERAMKEHKTIKNMSKE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Phosphorylation	----MRRTRSAVATG ----CCCCCCCCCCC	20.72	29472430
6	Phosphorylation	--MRRTRSAVATGPR --CCCCCCCCCCCCH	26.87	25521595
18	Phosphorylation	GPREQRRSGATGGLS CCHHHHHCCCCCCCC	34.66	25521595
21	Phosphorylation	EQRRSGATGGLSGGE HHHHCCCCCCCCCHH	34.99	25159016
25	Phosphorylation	SGATGGLSGGESRAQ CCCCCCCCCHHHHHH	48.29	23984901
29	Phosphorylation	GGLSGGESRAQRSRS CCCCCHHHHHHHHHH	35.87	23984901
39	Methylation	QRSRSRTRAGAGGGG HHHHHCCCCCCCCCC	29.88	24129315
56	Ubiquitination	VGPQPSAKPRPKPPP CCCCCCCCCCCCCCC	45.99	27667366
56	Malonylation	VGPQPSAKPRPKPPP CCCCCCCCCCCCCCC	45.99	32601280
78	Phosphorylation	EEPPPAVTPAASVSA CCCCCCCCCCCCCCC	14.87	28066266
82	Phosphorylation	PAVTPAASVSALDLG CCCCCCCCCCCCHHH	20.79	28066266
84	Phosphorylation	VTPAASVSALDLGEQ CCCCCCCCCCHHHHH	22.18	28066266
100	Ubiquitination	ERWETFQKRQRLSFE HHHHHHHHHHCCCHH	46.43	27667366
105	Phosphorylation	FQKRQRLSFEGAAKL HHHHHCCCHHHHHHH	24.36	25521595
137	Ubiquitination	HCGAVRFEVWASADL CCCCEEEEEEECCCE	26.96	27667366
173	Malonylation	ASRFKLLKGAESITT HHHHHHHCCCCEEEE	67.52	26320211
187	Malonylation	TYTFNTHKAQHTFCK EEEECCHHCCCEECC	47.94	32601280
206	Phosphorylation	QSFYTPRSNPGGFGI CEEECCCCCCCCCCC	48.88	29899451
217	S-palmitoylation	GFGIAPHCLDEGTVR CCCCCCHHCCCCCEE	5.08	28526873
228	Phosphorylation	GTVRSVVTEEFNGSD CCEEEEEEECCCCHH	27.86	28066266
234	Phosphorylation	VTEEFNGSDWERAMK EEECCCCHHHHHHHH	40.43	25521595
247	Ubiquitination	MKEHKTIKNMSKE-- HHHHHHHHHCCCC--	52.40	27667366
247	Malonylation	MKEHKTIKNMSKE-- HHHHHHHHHCCCC--	52.40	26320211

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CENPV_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CENPV_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CENPV_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of CENPV_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.