MRGBP_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MRGBP_MOUSE
• UniProt AC: Q9DAT2
• Protein Name: MRG/MORF4L-binding protein
• Gene Name: Mrgbp
• Organism: Mus musculus (Mouse).
• Sequence Length: 204
• Subcellular Localization: Nucleus.
• Protein Description: Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage..
• Protein Sequence: MGEAEVGGTGAPGDKGPGEAAPSPAEETVVWSPEVEVCLFHAMLGHKPVGVNRHFHMICIRDKFSQNIGRQVPSKVIWDHLSTMYDMQALHESEILPFPNPERNFVLPDEIIQEVREGKVVIEEEMKEEMKEDVDPHSGADDVFSSSGSLGKALEKSSKDKEKNSSDLGCKEGADKRKRSRVTDKVLTANSNPSSPSAAKRRRT

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MGEAEVGGT ------CCCCCCCCC	42.70	-
23	Phosphorylation	GPGEAAPSPAEETVV CCCCCCCCCHHHCEE	31.83	26060331
138	Phosphorylation	KEDVDPHSGADDVFS HHCCCCCCCHHHHHC	40.85	27841257
175 (in isoform 2)	Phosphorylation	-	41.15	29899451
185	Acetylation	KRSRVTDKVLTANSN HHHHHCCCEECCCCC	41.08	-
185	Acetylation	KRSRVTDKVLTANSN HHHHHCCCEECCCCC	41.08	22826441
188	Phosphorylation	RVTDKVLTANSNPSS HHCCCEECCCCCCCC	50.22	28833060
191	Phosphorylation	DKVLTANSNPSSPSA CCEECCCCCCCCHHH	25.98	27566939
194	Phosphorylation	LTANSNPSSPSAAKR ECCCCCCCCHHHHHH	34.00	27566939
195	Phosphorylation	TANSNPSSPSAAKRR CCCCCCCCHHHHHHC	2.55	25521595
197	Phosphorylation	NSNPSSPSAAKRRRT CCCCCCHHHHHHCCC	60.84	22942356

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MRGBP_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MRGBP_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MRGBP_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of MRGBP_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.