PCGF1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PCGF1_MOUSE
• UniProt AC: Q8R023
• Protein Name: Polycomb group RING finger protein 1
• Gene Name: Pcgf1
• Organism: Mus musculus (Mouse).
• Sequence Length: 259
• Subcellular Localization: Nucleus .
• Protein Description: Component of the Polycomb group (PcG) multiprotein BCOR complex, a complex required to maintain the transcriptionally repressive state of some genes, such as BCL6 and the cyclin-dependent kinase inhibitor, CDKN1A. Transcriptional repressor that may be targeted to the DNA by BCL6; this transcription repressor activity may be related to PKC signaling pathway. Represses CDKN1A expression by binding to its promoter, and this repression is dependent on the retinoic acid response element (RARE element). Promotes cell cycle progression and enhances cell proliferation as well. May have a positive role in tumor cell growth by down-regulating CDKN1A. Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. Within the PRC1-like complex, regulates RNF2 ubiquitin ligase activity. Regulates the expression of DPPA4 and NANOG in the NT2 embryonic carcinoma cells..
• Protein Sequence: MASPQGGQIAIAMRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDATTITECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQPLLNLKLDRVMQDIVYKLVPGLQDSEEKRIREFYQSRGLDRVSQPSGEEPALSNLGLPFSSFDHSKAHYYRYDEQLSLCLERLSSGKDKNKNVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQLWLSRWFGKPSPLLLQYSVKEKRR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MASPQGGQI ------CCCCCHHHH	29.89	-
3	Phosphorylation	-----MASPQGGQIA -----CCCCCHHHHH	19.23	25266776
21	Phosphorylation	RLRNQLQSVYKMDPL HHHHHHHHHHCCCCC	35.69	27600695
177	Phosphorylation	SLCLERLSSGKDKNK HHHHHHHHCCCCCCC	43.18	27149854

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PCGF1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PCGF1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PCGF1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
KDM2B_MOUSE	Kdm2b	physical	23395003
RING2_MOUSE	Rnf2	physical	23395003
RYBP_MOUSE	Rybp	physical	23395003
BCL6_HUMAN	BCL6	physical	26496610
TRI27_HUMAN	TRIM27	physical	26496610
RING1_HUMAN	RING1	physical	26496610
RING2_HUMAN	RNF2	physical	26496610
NELFA_HUMAN	NELFA	physical	26496610
UBP7_HUMAN	USP7	physical	26496610
MED14_HUMAN	MED14	physical	26496610
SCAM3_HUMAN	SCAMP3	physical	26496610
YAF2_HUMAN	YAF2	physical	26496610
RYBP_HUMAN	RYBP	physical	26496610
UHRF1_HUMAN	UHRF1	physical	26496610
HOOK2_HUMAN	HOOK2	physical	26496610
S61A1_HUMAN	SEC61A1	physical	26496610
BCOR_HUMAN	BCOR	physical	26496610
PTCD3_HUMAN	PTCD3	physical	26496610
LYRM4_HUMAN	LYRM4	physical	26496610
THA11_HUMAN	THAP11	physical	26496610
BCORL_HUMAN	BCORL1	physical	26496610
RT15_HUMAN	MRPS15	physical	26496610
NUP37_HUMAN	NUP37	physical	26496610
YIPF5_HUMAN	YIPF5	physical	26496610
ACTL8_HUMAN	ACTL8	physical	26496610
KDM2B_HUMAN	KDM2B	physical	26496610
CC124_HUMAN	CCDC124	physical	26496610
EVI5L_HUMAN	EVI5L	physical	26496610
RM52_HUMAN	MRPL52	physical	26496610
NOP9_HUMAN	NOP9	physical	26496610

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.